SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|49075|gm1.2292_g from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|49075|gm1.2292_g
Domain Number 1 Region: 222-414
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.38e-44
Family cAMP-binding domain 0.00038
Further Details:      
 
Domain Number 2 Region: 67-119,155-253
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000196
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|49075|gm1.2292_g
Sequence length 563
Sequence
MSHFNVPSTDIVSLLFHLTWAILIVDLLVCALTASTDRDDAIGLLPLNVLLANSHATSFA
SFHYFNRVLVLFRVWWWFERLNNRVMSMYVLWAVKAIVTLILGTHYLACVWWVIGRIDSD
WRNGIPSWSQQAAKSAQWKAVLSTDAQSPDAVWAPLWFRQYIVSLYWVVNMALIPEASHL
SVQSFQERWMGKVVYIVAQMYIAWIGSSLTSVLANSRAIRTTMQKRADVIMDFLKTSKLP
QHLRKRVKEYLNFSWLRNRGVDATTLLDDLPSTLRAELALKAYGHLLTKVPLFSGADDAF
FRALSLALRPILFLEGEDIVRQGDLGAEMFALLRGSVHIIAVAADGSEKILSTLHQGAYF
GEISLYLSRPRTVTVRAATRVDILVLTKQSLDAVLKLYPDVHSRIIAMAQERLRQDAQRA
GALTDPAAKEPQTPQVELEPASVVRPSQGLSNRRQSLLVSVAPRNVPFPPGEPFVSRSRR
MSRDRTVDRTVDMDGQSAVGSSSQHASRSPILKTPSGSPLPVGRPNADNLVNGAIMDKVT
TEKVHSQRAIHVEACNSRIPPAK
Download sequence
Identical sequences jgi|Catan1|49075|gm1.2292_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]