SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|56486|gm1.9703_g from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|56486|gm1.9703_g
Domain Number 1 Region: 87-510
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.18e-108
Family Pyridoxal-dependent decarboxylase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|56486|gm1.9703_g
Sequence length 548
Sequence
MDTVTNALAASGPRPLRAIKNILFVLFCLRILGAVHKSLVFRGLAGSLKHLLWTISKHAL
SSVRSLPTPAGSLINQQIQETLAGMEKSMCPPPKPGDPAPYLTLPPKGLNRDALRKEIAR
YRSMGHVDYKSGKVSGAVYHGGDDLSAIITEAYGAFSSSNPLHPDLFPGVRKMEAEVVRM
VVDMYHGGQAGCGNLTSGGTESILMACKAYRELAFTTRGITEPEMIVPDTIHAAFDKACH
YFKIKLVKIPIDSRDFRVRLDLVERAINSNTIMLAGSAPNFPHGIIDDIQGLSKLAIKHK
LPLHVDCCLGSFLMACMNDAGFSDIPAFDFRVPGVTSMSVDTHKYGFAPKGSSVIMYRNS
DYRKHQYFVAPDWTGGIYASPSIAGSRPGALIAGCWATMLSVGRDGYVDATRKIVGTARA
IANAIRNDPALSADIEVVGNPLVSVVAIRARQGVKLNIFAVNDVMSKAGWNLNALQFPEA
LHIACTYLTVGKEGVFVEDLKKAVREVKEHPEKYKDGSAAMYGMAASIPDRSIVADIVTG
YLDLMLKP
Download sequence
Identical sequences jgi|Catan1|56486|gm1.9703_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]