SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488570861|ref|YP_007908660.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488570861|ref|YP_007908660.1|
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.09e-58
Family Tetrapyrrole methylase 0.0007
Further Details:      
 
Domain Number 2 Region: 406-525
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.07e-20
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488570861|ref|YP_007908660.1|
Sequence length 549
Comment precorrin 3 methylase [Bacillus sp. 1NLA3E]
Sequence
MKGKLLVIGFGPGSFDHVTDRAREAIKESNMVIGYSTYVDLIEGLLTDQEIISTGMTEEV
SRAQEAVKQAELGNKVAVISSGDAGVYGMAGLIYEVLIEKGWKKETGVEVEIIPGISAIN
SCASLLGAPVMHDACTISLSDHLTPWNLIEKRIEAAASTDFVIALYNPKSGRRTRQIEEA
QKILLKYRSPETPVGLVKSAYRDRQQVIVTNLKEMLEHEIGMLTTVIIGNSATFLYEGLM
ITPRGYQRKYTLGQTEQPLKLHQRLQKDAEPWALEQFSQAIGQQNEHKAEVSLREIAELA
LKAVSSEKHEQIGLSVTNQTFDQIERSATNQTFDQIFELAVSPGVANKQFTAKQMIILAE
VVGEKGVIEYTQDHNMKLQVPTSDPNQIIKILTEAGFILSPVGDVLTVKACDFCDGDKRD
PIPYAEELQNRLGGMELPKELKLGFNGCGMACYGAVKEDIGIVYRQGAFDLFIGGKTAGR
TAHPGQIVAEGIDPSKIVGIVENIIADYNNRAYPNERFYKFFKRVKQVEGFIFVDIMPKL
QIAEAACGE
Download sequence
Identical sequences N0AUR5
WP_015592226.1.96367 gi|488570861|ref|YP_007908660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]