SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488571144|ref|YP_007908943.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488571144|ref|YP_007908943.1|
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 1.7e-45
Family Hypothetical protein YfhH 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488571144|ref|YP_007908943.1|
Sequence length 109
Comment hypothetical protein B1NLA3E_03340 [Bacillus sp. 1NLA3E]
Sequence
MQQEKRYSNLNEFELRQEIATLNEKAKKAEQLGMVNEYAVLERKVVMAKAYLLNPEDFLP
GEIYEIIGDPGAYFKVDYLNGVFAWGYRLNGDGKEEALPISMLKIEARN
Download sequence
Identical sequences N0AM93
WP_015592507.1.96367 gi|488571144|ref|YP_007908943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]