SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488571679|ref|YP_007909478.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488571679|ref|YP_007909478.1|
Domain Number 1 Region: 194-608
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.26e-98
Family beta-Lactamase/D-ala carboxypeptidase 0.00000372
Further Details:      
 
Domain Number 2 Region: 55-243
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.19e-45
Family Penicillin binding protein dimerisation domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 601-655
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0066
Further Details:      
 
Domain Number 4 Region: 658-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000105
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488571679|ref|YP_007909478.1|
Sequence length 740
Comment peptidoglycan glycosyltransferase [Bacillus sp. 1NLA3E]
Sequence
MIKKQPNMNIGAAILFVIFSLLFFVLLFHYLSMQITGEAHGQVLAAKAQQKYTKESVIDA
SRGTIYDRKGEVVAKDTTSYKIVAILDKKMTTDPKNPKHVVDPAMTARKLAKYIPMSENE
IYKQLSKKGPFQVEFGNAGRDVSHQVKTEIEALKLPGITFMRDKKRFYPNGIFASHLVGF
VEKKEEKDGSSKTVGQLGVESTLNDVLTGKNGKVDYESDLWGYLLPDGKEKITPAHDGDD
VYLTIDKSIQTFLEDAMNKVVAEYKPQKMIAIVADPKTGEILAMGQRPTFHPKTREGLEK
SWRNEAIEDSFEPGSTMKIFTLSAAVNEGAFNPNELYQSGSYKVTPNSKSIHDHNGVGWG
TISFLEGVQRSSNVGFARLANEKLGFDKFREYLTKFGFDGPTGIDLPNETSGSIVFRYPI
DKVTTAFGQGTAITPIQQIQAATAVANDGKMMKPHVISKIVDPNTGKTIKEEKPEVAGTP
ISAETAKEVRDILGTVITSPNGTGSRYRIDGYDIAGKTGTAQIPGAKGYLTGAKNYVFSF
LGMAPKDDPKLVVYVAVQQPEIESYFDGSIPVSMIFNPVMKNSLQYLNIKPGSVEKAKIN
TLPNLTQMSIEGAKETLNQKGLQHVIIGDGSTVIEQLPAQNEEILEGEKVVLKTDGNLKM
PDLTGWSRRDVMKIAKVAGLKLTVSGTGYVITQNIEQGTVLTKGSYLIVDCKVPTEVKEK
SEKDKSKKDTVNNQEVDVQD
Download sequence
Identical sequences N0AP07
WP_015593039.1.96367 gi|488571679|ref|YP_007909478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]