SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488573101|ref|YP_007910900.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488573101|ref|YP_007910900.1|
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 2 Region: 625-766
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.55e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 143-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.67e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 4 Region: 490-614
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.98e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.031
Further Details:      
 
Weak hits

Sequence:  gi|488573101|ref|YP_007910900.1|
Domain Number - Region: 428-491
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0424
Family 2Fe-2S ferredoxin-related 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488573101|ref|YP_007910900.1|
Sequence length 784
Comment nitrate reductase, electron transfer subunit [Bacillus sp. 1NLA3E]
Sequence
MTKQKLVLIGNGMAGVRCIEEIIKNDPDAFEITIFGSEPHANYNRILLSTVLQGMTSVED
ITINDRDWYEEHHIQLFTGETVIKINKEKKLVRSDKDREVSYDKLILATGSVPFHLPLPG
ADKEGVIAFRTIEDCRKMIETSKKYKKAVVIGGGLLGLEAARGLLNLGMEVNVVHIARYL
MERQLDPTAAKMLQKELESQGMNFLLEKETQKIIGNQRVEGLRFKDGTEVEADLVVMAVG
VRPNVQLAKDSGIETNRAIIVNDYLKTNTPNVYAVGECVEHRGMVYGLVKPLYEQGQVLA
KHICGIDCKGYEGSILSTHLKISGVNVFSVGQFAGGKTTKEITIFDELVGIYKKIVFQDS
KMVGAVLFGDTRDGTRLLEMIIKKKDVLDAEKVLLLQSSNGDEHSVASMAYSEIICNCNI
VTKGMIIEAVQKEGLSTIEQVKTCTKASGSCGGCKRLVTDLLSYIQSDEHDEEMEQKSMC
SCTSLMEDEVVHEMQLLGLTSVEEVMDKLEWENKQGCSTCRPALNYYLGMIFPEYESKQE
ILFVSERMNATVQDNGTYSVIPQMFGGMTTAEQLRKIANVAEKYAISNVAVTSEQRIHLM
GIKSEDLSGVWADLNMPLSSTYKNMVQNVKTCIGEHVCQCNKYPSLKLAVKLEKKTEFVT
TPYRVKIGVSSCMHNGAGSTTKDIGVIGTDRGWEIYVGGSSGRNVRVGELLCVAGTKDEA
MEVISGFIQYYRETGNYLERTWEWLERLGLIHVREVLFDQELRHQLLKRLDEDKSWRKRM
AQKG
Download sequence
Identical sequences N0B175
WP_015594454.1.96367 gi|488573101|ref|YP_007910900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]