SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488572813|ref|YP_007910612.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488572813|ref|YP_007910612.1|
Domain Number 1 Region: 382-460
Classification Level Classification E-value
Superfamily TPR-like 0.0000000207
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  gi|488572813|ref|YP_007910612.1|
Domain Number - Region: 235-346
Classification Level Classification E-value
Superfamily ARM repeat 0.0108
Family Armadillo repeat 0.065
Further Details:      
 
Domain Number - Region: 174-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0392
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488572813|ref|YP_007910612.1|
Sequence length 464
Comment hypothetical protein B1NLA3E_11815 [Bacillus sp. 1NLA3E]
Sequence
MNEDQFLLYDHQKPILLKAEKISFYLQGEIIEAFTENNEVYYLIFYKYQFLTAVKAIRLR
RKSYIEDSFKKGMVFNAPHPFINGLLSSNAPLKIISFQPLIKKLDRLYTPQEKSFILTFF
ESFFPKKQLFEQINSVFFEYRRNGQMFLGYRIIRILMDFAPKHSLVKQLANDSMFNKYAD
LYNQKSEKLFAKDLIFAEKTLYAQKDNEECFQQLVALMEKESRWIDLSSLLIYKLSQTPS
IDYYQLLLDQLEKHLSENETVQILEKLSNDLPSFLPLQKELFEKYVKNFKIEKVLNMMNS
YHFQLNSSQVQALGDILDCVDSEGQSFQPEVLKDLLKSYIDFFPEKAEILLNKYVISLLK
THELDYIKEWLNPFMKNHQCLKIFEKIDTMKRLNEDLDQMQTLGELYVEFGQFEKAIECF
SWEMELKPTNTKPLQWLSKIYREMGMNHEADAFRELCIDIQKWA
Download sequence
Identical sequences N0ATW2
WP_015594169.1.96367 gi|488572813|ref|YP_007910612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]