SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488574459|ref|YP_007912258.1| from Bacillus sp. 1NLA3E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488574459|ref|YP_007912258.1|
Domain Number 1 Region: 513-624
Classification Level Classification E-value
Superfamily TPR-like 0.00000000778
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  gi|488574459|ref|YP_007912258.1|
Domain Number - Region: 683-732
Classification Level Classification E-value
Superfamily TPR-like 0.0664
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488574459|ref|YP_007912258.1|
Sequence length 762
Comment O-antigen polymerase [Bacillus sp. 1NLA3E]
Sequence
MRFKKWEDFAVRWFLFILLSAIFIISPYKKGLYFISDQYSLFVLIAVLSMLLLSFLVIRK
ELNSLKVLSILLLLPLSYLLSLPFAVSPQGAYDNVIKWGMYCAFFLLLYWSSFDQKNKKT
MPVVFQFTGISISLLMLLVYYNFFSFPNYMVDGRFAGVFLHPNTFGMVMTLYFLFSISLL
TKKSISLKILFFYATPIVPFFVCMVQSNFTGMLPFFSISWLIGLILLPFKKQVEYLLYSI
ISVACSIFAIKSMTSETGLLIILLMSLLSTFLIVLIKKVKRQKELNNENIYLYSEKIGLY
LILTVFITSLCFLTLLDLKNEGLGFKTLPSKLQDTIQGLSINAVTEEHFISLKDVLNMSK
DSPIIGFGGEGWATAYKSYQQSPYQSNEIYNGYLEWIIDTGWIGFSFFSIVFAILFYLTL
KTYIKKQDSSLVAGSITALFTIFIHSFIDFDFSYGTIWFLVFWLFAMAIDIKHDPSIKRS
NVNTMIGKRMVPIIVSILSILLIISSVLSLRFLIAATYFEKSKKNQSITMQKELLQKAVS
NHPSNINYLTKLSNIYLQLAKDDKTKNYKIELNELITRMVTLEPENSSVLYNAAVIAKSI
GENQKAILIIDEALKKDHYNTKLYEKGMQIKLQFALVENSNVKRKYANLVLDDYQEIMYW
NRMVDNNQFSGANNNRNFLLTKNVNYYASLSYYLLKDYKKVINIYSQNKKLFNNDKRMIA
LTILALEKEGEFNQSSKLYLIENDSTETKHFVKILKKKLDNL
Download sequence
Identical sequences N0AXB3
gi|488574459|ref|YP_007912258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]