SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cd36_16050 from Candida dubliniensis CD36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cd36_16050
Domain Number 1 Region: 2-408
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.59e-98
Family IF2B-like 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cd36_16050
Sequence length 424
Comment |||methylthioribose-1-phosphate isomerase, putative|Candida dubliniensis|chr 2|||Manual
Sequence
MSTTTRTLQAIKFDRNNIKLEILDQLLLPYSTTYIPITSIEDAFKAIKLMQVRGAPAIAI
VGAFSVVVEVSNYLKQSDSNRKTIENLNDSLDYLITSRPTAVNLANALNDIKQLLQEFND
TDIINEKIYQQIYDYAIALYDEDLANNKKIGENGLKYIINTLTEQNFKGPFSIMTICNTG
SLATSGHGTALGIIRSTYQALQKNNSKEEFWLDHIYPCETRPYNQGAKLTTYELDYEQIP
FTLICDNMVSSLINTLSDDDNKKPIKTNQISPVKFIIVGADRIVENGDTANKIGTFQLST
IANFFNNNKFIQQQLKSNTTKTTINKEIKFIVAAPKTTIDLNTKTGDDIVIEERPANELT
TLVGPLLNEAGDVGEKLTVGIATPGISVWNPAFDVTPHELIDSIVTEDPHVFTKDENGEF
NLIK
Download sequence
Identical sequences Cd36_16050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]