SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cd36_33690 from Candida dubliniensis CD36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cd36_33690
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.8e-24
Family Phosphate binding protein-like 0.028
Further Details:      
 
Weak hits

Sequence:  Cd36_33690
Domain Number - Region: 198-293
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0133
Family Apolipophorin-III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cd36_33690
Sequence length 299
Comment |||conserved hypothetical protein|Candida dubliniensis|chr R|||Manual
Sequence
MPTLKVAYIPEHFSTPLFFAQQQGYYKAHDLSIEFVKVPEGSGRLINLLNSNEVDIAIGL
TEAFIADIAKGNANIHVLDTYVKSPLLWAVSTGYHRDDVTDAKHLKRIGVSRIGSGSYVM
SFVLAHQLGIPSFDQFQVLSNFKNLRDSVNLKDGVEGSDAFMWEYFTSKRYYDNHEIKQI
DQIYTPWSSWVVATSSNSLQTKSDAVKNFLDAVHEGIQYYNGNINEAIEYISSNLDYSAE
DAKEWTKTVEFNSNIGRTPLDWDTVVVKTKDTLKLAGVLTESDDTILKRLNSNVKKTNL
Download sequence
Identical sequences B9WMJ6
XP_002422305.1.45354 573826.CD36_33690 Cd36_33690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]