SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CE08545___KOG0258 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CE08545___KOG0258
Domain Number 1 Region: 31-498
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.7e-65
Family AAT-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CE08545___KOG0258
Sequence length 554
Sequence
MRTVQAISGLVTSRFFGTSTRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKEL
ATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAF
LGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLF
INHNNAKKVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKE
YDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKK
VLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTV
LGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAM
YAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILP
QPELFKDMLSRFTDFHQKFLAEYKRLYCHFHLTNNRTSDSFWHTLIDGFPKYKVFVQNRR
STQCAFHSIQLSRF
Download sequence
Identical sequences CE08545___KOG0258 354105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]