SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR296c___KOG1358 from Core Eukaryotic Genes 458

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR296c___KOG1358
Domain Number 1 Region: 143-457,496-547
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-59
Family GABA-aminotransferase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR296c___KOG1358
Sequence length 558
Sequence
MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVE
IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAK
TPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGAC
GPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL
PVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDL
APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS
TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSL
HDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNK
FIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKN
ACESVKQSILACCQESNK
Download sequence
Identical sequences A0A0L8VJF4 A0A250WE34 A6ZN12 B3LMI4 B5VQ63 C7GTK3 E7KGL9 E7NLV8 E7Q7Y7 E7QIT4 P25045
YMR296C YMR296C YMR296C YMR296C tr|A6ZN12|A6ZN12_YEAS7 YMR296c___KOG1358 YMR296C YMR296C NP_014025.1.97178 YMR296C SCRT_02193 YMR296C YMR296C YMR296C YMR296C YMR296C 4932.YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]