SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|499143895|ref|YP_007975959.1| from Streptococcus suis TL13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|499143895|ref|YP_007975959.1|
Domain Number 1 Region: 61-315
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.14e-62
Family L-arabinose binding protein-like 0.000084
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.33e-16
Family GalR/LacI-like bacterial regulator 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|499143895|ref|YP_007975959.1|
Sequence length 321
Comment Sucrose operon repressor ScrR, LacI family [Streptococcus suis TL13]
Sequence
MVAKLTDVAQLAGVSPTTVSRVINKKGYLSEKTIRNVEEAMRELGYKPNNLARSLQGKSA
KLVGLIFPTINNIFYSELISHLEKELFDRGYKTIICNSQHESDKEREYLEMLAANQVDGI
ISGSHNLGIQDYDRVVAPIIAFDRNLSPSIPIVSSDNFAGGVLAAQTLQKAGCHNPLMIT
GNDDSNSPTGLRQVGFTSILNKAEVFHISSDFSPVRKEMEIRAILEKQKPDGIFVSGDAT
AMLVWNVIRSMKLSIPEDIKLIGYDGTSFIENYYPQLTTIKQPLTEIARLLVELLVDKIE
GKKLTKTDYILPISLLAGASI
Download sequence
Identical sequences A0A0H3N1G8 A0A0K2E831 G7SMD2
gi|386584840|ref|YP_006081243.1| gi|499143895|ref|YP_007975959.1| 568814.SSUBM407_1693 gi|253756249|ref|YP_003029389.1| gi|389857328|ref|YP_006359571.1| gi|330833432|ref|YP_004402257.1| WP_002938271.1.100661 WP_002938271.1.100670 WP_002938271.1.100904 WP_002938271.1.101621 WP_002938271.1.101829 WP_002938271.1.101901 WP_002938271.1.101939 WP_002938271.1.10539 WP_002938271.1.10700 WP_002938271.1.11017 WP_002938271.1.11527 WP_002938271.1.12368 WP_002938271.1.1244 WP_002938271.1.12665 WP_002938271.1.12908 WP_002938271.1.13095 WP_002938271.1.13139 WP_002938271.1.13153 WP_002938271.1.1370 WP_002938271.1.14775 WP_002938271.1.14903 WP_002938271.1.15374 WP_002938271.1.15756 WP_002938271.1.1608 WP_002938271.1.16498 WP_002938271.1.16677 WP_002938271.1.16683 WP_002938271.1.16829 WP_002938271.1.16881 WP_002938271.1.17649 WP_002938271.1.17814 WP_002938271.1.17824 WP_002938271.1.18076 WP_002938271.1.1810 WP_002938271.1.18403 WP_002938271.1.19016 WP_002938271.1.19097 WP_002938271.1.19145 WP_002938271.1.1918 WP_002938271.1.19625 WP_002938271.1.19757 WP_002938271.1.19898 WP_002938271.1.1991 WP_002938271.1.20931 WP_002938271.1.20963 WP_002938271.1.20983 WP_002938271.1.21016 WP_002938271.1.21156 WP_002938271.1.21217 WP_002938271.1.21374 WP_002938271.1.21688 WP_002938271.1.21903 WP_002938271.1.22347 WP_002938271.1.22433 WP_002938271.1.22462 WP_002938271.1.22805 WP_002938271.1.22848 WP_002938271.1.23074 WP_002938271.1.23225 WP_002938271.1.23682 WP_002938271.1.23965 WP_002938271.1.24086 WP_002938271.1.24208 WP_002938271.1.24431 WP_002938271.1.24550 WP_002938271.1.24875 WP_002938271.1.25245 WP_002938271.1.25617 WP_002938271.1.25711 WP_002938271.1.26183 WP_002938271.1.26324 WP_002938271.1.26329 WP_002938271.1.26507 WP_002938271.1.26620 WP_002938271.1.27227 WP_002938271.1.27695 WP_002938271.1.2789 WP_002938271.1.28099 WP_002938271.1.29299 WP_002938271.1.29545 WP_002938271.1.2991 WP_002938271.1.29935 WP_002938271.1.30079 WP_002938271.1.30094 WP_002938271.1.30344 WP_002938271.1.31254 WP_002938271.1.31418 WP_002938271.1.32213 WP_002938271.1.32258 WP_002938271.1.32292 WP_002938271.1.32332 WP_002938271.1.32342 WP_002938271.1.33297 WP_002938271.1.33377 WP_002938271.1.33471 WP_002938271.1.33494 WP_002938271.1.34222 WP_002938271.1.34462 WP_002938271.1.34652 WP_002938271.1.3475 WP_002938271.1.35306 WP_002938271.1.35725 WP_002938271.1.35749 WP_002938271.1.36153 WP_002938271.1.36251 WP_002938271.1.36365 WP_002938271.1.36437 WP_002938271.1.36774 WP_002938271.1.37688 WP_002938271.1.37816 WP_002938271.1.37915 WP_002938271.1.38285 WP_002938271.1.39228 WP_002938271.1.39263 WP_002938271.1.39983 WP_002938271.1.40265 WP_002938271.1.40278 WP_002938271.1.40872 WP_002938271.1.40962 WP_002938271.1.41052 WP_002938271.1.41522 WP_002938271.1.41854 WP_002938271.1.42735 WP_002938271.1.42827 WP_002938271.1.43193 WP_002938271.1.43929 WP_002938271.1.44200 WP_002938271.1.44378 WP_002938271.1.44592 WP_002938271.1.4480 WP_002938271.1.4529 WP_002938271.1.47375 WP_002938271.1.47449 WP_002938271.1.47745 WP_002938271.1.47869 WP_002938271.1.48076 WP_002938271.1.48370 WP_002938271.1.48583 WP_002938271.1.48616 WP_002938271.1.49099 WP_002938271.1.50127 WP_002938271.1.50188 WP_002938271.1.52490 WP_002938271.1.52559 WP_002938271.1.53030 WP_002938271.1.53412 WP_002938271.1.5344 WP_002938271.1.53749 WP_002938271.1.53872 WP_002938271.1.54800 WP_002938271.1.55064 WP_002938271.1.5509 WP_002938271.1.55319 WP_002938271.1.55707 WP_002938271.1.55815 WP_002938271.1.55924 WP_002938271.1.56140 WP_002938271.1.56150 WP_002938271.1.56434 WP_002938271.1.56719 WP_002938271.1.56848 WP_002938271.1.57164 WP_002938271.1.57286 WP_002938271.1.57294 WP_002938271.1.57938 WP_002938271.1.58077 WP_002938271.1.58281 WP_002938271.1.58585 WP_002938271.1.58725 WP_002938271.1.58815 WP_002938271.1.59138 WP_002938271.1.59647 WP_002938271.1.59702 WP_002938271.1.59929 WP_002938271.1.60233 WP_002938271.1.60293 WP_002938271.1.60377 WP_002938271.1.60659 WP_002938271.1.6071 WP_002938271.1.61024 WP_002938271.1.61034 WP_002938271.1.61370 WP_002938271.1.61721 WP_002938271.1.61885 WP_002938271.1.62112 WP_002938271.1.62268 WP_002938271.1.62743 WP_002938271.1.63653 WP_002938271.1.6377 WP_002938271.1.63815 WP_002938271.1.64009 WP_002938271.1.64120 WP_002938271.1.65074 WP_002938271.1.65090 WP_002938271.1.65174 WP_002938271.1.65314 WP_002938271.1.6605 WP_002938271.1.66347 WP_002938271.1.66521 WP_002938271.1.66609 WP_002938271.1.6690 WP_002938271.1.67256 WP_002938271.1.67338 WP_002938271.1.6758 WP_002938271.1.67883 WP_002938271.1.67897 WP_002938271.1.683 WP_002938271.1.68739 WP_002938271.1.68941 WP_002938271.1.6967 WP_002938271.1.69698 WP_002938271.1.69806 WP_002938271.1.70257 WP_002938271.1.70301 WP_002938271.1.70310 WP_002938271.1.70390 WP_002938271.1.70817 WP_002938271.1.70832 WP_002938271.1.71432 WP_002938271.1.71462 WP_002938271.1.71498 WP_002938271.1.718 WP_002938271.1.71911 WP_002938271.1.71914 WP_002938271.1.72030 WP_002938271.1.72174 WP_002938271.1.72924 WP_002938271.1.73272 WP_002938271.1.74090 WP_002938271.1.74132 WP_002938271.1.74554 WP_002938271.1.74800 WP_002938271.1.75022 WP_002938271.1.75229 WP_002938271.1.7537 WP_002938271.1.75965 WP_002938271.1.76811 WP_002938271.1.7739 WP_002938271.1.7763 WP_002938271.1.77752 WP_002938271.1.78021 WP_002938271.1.78456 WP_002938271.1.78744 WP_002938271.1.78792 WP_002938271.1.7884 WP_002938271.1.78883 WP_002938271.1.7889 WP_002938271.1.78901 WP_002938271.1.79154 WP_002938271.1.79610 WP_002938271.1.79644 WP_002938271.1.79679 WP_002938271.1.79846 WP_002938271.1.79901 WP_002938271.1.80025 WP_002938271.1.80169 WP_002938271.1.80952 WP_002938271.1.8124 WP_002938271.1.81372 WP_002938271.1.82122 WP_002938271.1.82418 WP_002938271.1.82695 WP_002938271.1.82772 WP_002938271.1.82894 WP_002938271.1.83058 WP_002938271.1.83087 WP_002938271.1.8344 WP_002938271.1.8414 WP_002938271.1.8422 WP_002938271.1.84412 WP_002938271.1.84535 WP_002938271.1.8514 WP_002938271.1.85327 WP_002938271.1.85333 WP_002938271.1.85450 WP_002938271.1.86639 WP_002938271.1.86830 WP_002938271.1.86842 WP_002938271.1.86886 WP_002938271.1.87005 WP_002938271.1.87344 WP_002938271.1.87405 WP_002938271.1.87438 WP_002938271.1.87450 WP_002938271.1.87874 WP_002938271.1.88173 WP_002938271.1.88201 WP_002938271.1.88233 WP_002938271.1.88626 WP_002938271.1.88635 WP_002938271.1.88787 WP_002938271.1.89128 WP_002938271.1.89156 WP_002938271.1.89596 WP_002938271.1.90058 WP_002938271.1.90419 WP_002938271.1.90634 WP_002938271.1.90917 WP_002938271.1.92584 WP_002938271.1.928 WP_002938271.1.93456 WP_002938271.1.93510 WP_002938271.1.93771 WP_002938271.1.93914 WP_002938271.1.94291 WP_002938271.1.94419 WP_002938271.1.94780 WP_002938271.1.94945 WP_002938271.1.95351 WP_002938271.1.95387 WP_002938271.1.95472 WP_002938271.1.95788 WP_002938271.1.96451 WP_002938271.1.96717 WP_002938271.1.97504 WP_002938271.1.97722 WP_002938271.1.97814 WP_002938271.1.98089 WP_002938271.1.98431 WP_002938271.1.98464 WP_002938271.1.98889 WP_002938271.1.99664 YP_003029389.1.79686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]