SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|499144217|ref|YP_007976281.1| from Streptococcus suis TL13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|499144217|ref|YP_007976281.1|
Domain Number 1 Region: 60-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.08e-45
Family L-arabinose binding protein-like 0.0000769
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.25e-16
Family GalR/LacI-like bacterial regulator 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|499144217|ref|YP_007976281.1|
Sequence length 327
Comment Maltose operon transcriptional repressor MalR, LacI family [Streptococcus suis TL13]
Sequence
MRATIKDVAKLAGVSPSTVTRVIQNSSAISQKTKDLVRKAMADLNYHPNLNARSLVSSYT
QVIGLVLPDDSDVFYQNPFFPTALRGISQVAADHNYAIQISTGKNEEQRLEAISQMVYGK
RVDGLIFLYSKPDDPLVQLAIQHKFPFLILGKADSPFISLVDNDNIQAGFEATNYFINKG
YKNIAFVAGNKELVVSQDRYTGYKNALKSHNIPLDENKVKFVSGFLLEDSAYKISKKLLK
QDLDAIVTTDTSVAEGVVKYLNEVGVKLPIISFDSVKPKLDIEAYVDVHAIKLGRVAFNT
LHQIINDNKEDKQVCYRRVIPHTITEL
Download sequence
Identical sequences A0A075SM97 A0A0H3N2C9 A0A0K2E8Y4 A4VYB4 D5AF03 G7SGI4 G7SJV3 U5UHP7
gi|386580998|ref|YP_006077403.1| gi|146321986|ref|YP_001201697.1| gi|386583075|ref|YP_006079479.1| gi|386585143|ref|YP_006081546.1| gi|556589748|ref|YP_008757302.1| gi|146319791|ref|YP_001199503.1| gi|253756530|ref|YP_003029670.1| gi|253752772|ref|YP_003025913.1| WP_002936122.1.10007 WP_002936122.1.100280 WP_002936122.1.100404 WP_002936122.1.100490 WP_002936122.1.10052 WP_002936122.1.100661 WP_002936122.1.100670 WP_002936122.1.100701 WP_002936122.1.100904 WP_002936122.1.100908 WP_002936122.1.101097 WP_002936122.1.101179 WP_002936122.1.101295 WP_002936122.1.10137 WP_002936122.1.101447 WP_002936122.1.101621 WP_002936122.1.101658 WP_002936122.1.101706 WP_002936122.1.101829 WP_002936122.1.101901 WP_002936122.1.101939 WP_002936122.1.102003 WP_002936122.1.102038 WP_002936122.1.10265 WP_002936122.1.1035 WP_002936122.1.10539 WP_002936122.1.10700 WP_002936122.1.10896 WP_002936122.1.10904 WP_002936122.1.11330 WP_002936122.1.11527 WP_002936122.1.11548 WP_002936122.1.11662 WP_002936122.1.11845 WP_002936122.1.11869 WP_002936122.1.11874 WP_002936122.1.11918 WP_002936122.1.1200 WP_002936122.1.12022 WP_002936122.1.12228 WP_002936122.1.12288 WP_002936122.1.12368 WP_002936122.1.1244 WP_002936122.1.12606 WP_002936122.1.12665 WP_002936122.1.12803 WP_002936122.1.12908 WP_002936122.1.13051 WP_002936122.1.13095 WP_002936122.1.13153 WP_002936122.1.13212 WP_002936122.1.1324 WP_002936122.1.13380 WP_002936122.1.13633 WP_002936122.1.1370 WP_002936122.1.13861 WP_002936122.1.14009 WP_002936122.1.1405 WP_002936122.1.14202 WP_002936122.1.14210 WP_002936122.1.1424 WP_002936122.1.1434 WP_002936122.1.14359 WP_002936122.1.14775 WP_002936122.1.14903 WP_002936122.1.1495 WP_002936122.1.15035 WP_002936122.1.15112 WP_002936122.1.1537 WP_002936122.1.15374 WP_002936122.1.15393 WP_002936122.1.15414 WP_002936122.1.15545 WP_002936122.1.15813 WP_002936122.1.1608 WP_002936122.1.1616 WP_002936122.1.16193 WP_002936122.1.16255 WP_002936122.1.16271 WP_002936122.1.1629 WP_002936122.1.16498 WP_002936122.1.16643 WP_002936122.1.16677 WP_002936122.1.16683 WP_002936122.1.16773 WP_002936122.1.16829 WP_002936122.1.16881 WP_002936122.1.17191 WP_002936122.1.17264 WP_002936122.1.17388 WP_002936122.1.17549 WP_002936122.1.17649 WP_002936122.1.17663 WP_002936122.1.17670 WP_002936122.1.17730 WP_002936122.1.17749 WP_002936122.1.17824 WP_002936122.1.17958 WP_002936122.1.17989 WP_002936122.1.18076 WP_002936122.1.1810 WP_002936122.1.18271 WP_002936122.1.18341 WP_002936122.1.18403 WP_002936122.1.18563 WP_002936122.1.18711 WP_002936122.1.18850 WP_002936122.1.19097 WP_002936122.1.19145 WP_002936122.1.1918 WP_002936122.1.19352 WP_002936122.1.19378 WP_002936122.1.19521 WP_002936122.1.1953 WP_002936122.1.19625 WP_002936122.1.19757 WP_002936122.1.19865 WP_002936122.1.19898 WP_002936122.1.1991 WP_002936122.1.20400 WP_002936122.1.20518 WP_002936122.1.20584 WP_002936122.1.20756 WP_002936122.1.20792 WP_002936122.1.20819 WP_002936122.1.20931 WP_002936122.1.20944 WP_002936122.1.20963 WP_002936122.1.20983 WP_002936122.1.21016 WP_002936122.1.21072 WP_002936122.1.21156 WP_002936122.1.21217 WP_002936122.1.21347 WP_002936122.1.21348 WP_002936122.1.21374 WP_002936122.1.21457 WP_002936122.1.21793 WP_002936122.1.21903 WP_002936122.1.21994 WP_002936122.1.22347 WP_002936122.1.22433 WP_002936122.1.22462 WP_002936122.1.22560 WP_002936122.1.22785 WP_002936122.1.22805 WP_002936122.1.22848 WP_002936122.1.22882 WP_002936122.1.23074 WP_002936122.1.23089 WP_002936122.1.23225 WP_002936122.1.23273 WP_002936122.1.23317 WP_002936122.1.23358 WP_002936122.1.23682 WP_002936122.1.23965 WP_002936122.1.24078 WP_002936122.1.24086 WP_002936122.1.24150 WP_002936122.1.24175 WP_002936122.1.24187 WP_002936122.1.24431 WP_002936122.1.24550 WP_002936122.1.24858 WP_002936122.1.24875 WP_002936122.1.24883 WP_002936122.1.25280 WP_002936122.1.25381 WP_002936122.1.25396 WP_002936122.1.25617 WP_002936122.1.25711 WP_002936122.1.25798 WP_002936122.1.25824 WP_002936122.1.25841 WP_002936122.1.25950 WP_002936122.1.26009 WP_002936122.1.26183 WP_002936122.1.26302 WP_002936122.1.26324 WP_002936122.1.26329 WP_002936122.1.26368 WP_002936122.1.26507 WP_002936122.1.26620 WP_002936122.1.27108 WP_002936122.1.27225 WP_002936122.1.27227 WP_002936122.1.27381 WP_002936122.1.27476 WP_002936122.1.27754 WP_002936122.1.27760 WP_002936122.1.27767 WP_002936122.1.2789 WP_002936122.1.28000 WP_002936122.1.28033 WP_002936122.1.28099 WP_002936122.1.28244 WP_002936122.1.28467 WP_002936122.1.28645 WP_002936122.1.28796 WP_002936122.1.28805 WP_002936122.1.28908 WP_002936122.1.29141 WP_002936122.1.29299 WP_002936122.1.29542 WP_002936122.1.29545 WP_002936122.1.29610 WP_002936122.1.29635 WP_002936122.1.2991 WP_002936122.1.29935 WP_002936122.1.30079 WP_002936122.1.30094 WP_002936122.1.30136 WP_002936122.1.30241 WP_002936122.1.30344 WP_002936122.1.30414 WP_002936122.1.30562 WP_002936122.1.30785 WP_002936122.1.31254 WP_002936122.1.31418 WP_002936122.1.31425 WP_002936122.1.31597 WP_002936122.1.31707 WP_002936122.1.31730 WP_002936122.1.31763 WP_002936122.1.32048 WP_002936122.1.32213 WP_002936122.1.32259 WP_002936122.1.32292 WP_002936122.1.32332 WP_002936122.1.32342 WP_002936122.1.32380 WP_002936122.1.32466 WP_002936122.1.32630 WP_002936122.1.32947 WP_002936122.1.33254 WP_002936122.1.33297 WP_002936122.1.33330 WP_002936122.1.33353 WP_002936122.1.33377 WP_002936122.1.33471 WP_002936122.1.33494 WP_002936122.1.34222 WP_002936122.1.34321 WP_002936122.1.34425 WP_002936122.1.34462 WP_002936122.1.34527 WP_002936122.1.34738 WP_002936122.1.3475 WP_002936122.1.35306 WP_002936122.1.35430 WP_002936122.1.35551 WP_002936122.1.35675 WP_002936122.1.35749 WP_002936122.1.36126 WP_002936122.1.36136 WP_002936122.1.36153 WP_002936122.1.36180 WP_002936122.1.36341 WP_002936122.1.36365 WP_002936122.1.36437 WP_002936122.1.36611 WP_002936122.1.36766 WP_002936122.1.36774 WP_002936122.1.36945 WP_002936122.1.37126 WP_002936122.1.37237 WP_002936122.1.376 WP_002936122.1.37653 WP_002936122.1.37688 WP_002936122.1.37816 WP_002936122.1.37841 WP_002936122.1.37914 WP_002936122.1.37915 WP_002936122.1.38285 WP_002936122.1.38409 WP_002936122.1.38470 WP_002936122.1.39011 WP_002936122.1.39023 WP_002936122.1.39228 WP_002936122.1.39247 WP_002936122.1.39263 WP_002936122.1.39280 WP_002936122.1.39714 WP_002936122.1.3989 WP_002936122.1.39983 WP_002936122.1.40062 WP_002936122.1.40141 WP_002936122.1.40169 WP_002936122.1.40228 WP_002936122.1.40265 WP_002936122.1.40278 WP_002936122.1.40384 WP_002936122.1.40507 WP_002936122.1.40669 WP_002936122.1.4074 WP_002936122.1.40802 WP_002936122.1.40962 WP_002936122.1.41046 WP_002936122.1.41052 WP_002936122.1.41112 WP_002936122.1.41280 WP_002936122.1.41340 WP_002936122.1.41522 WP_002936122.1.42206 WP_002936122.1.42323 WP_002936122.1.42552 WP_002936122.1.42596 WP_002936122.1.42732 WP_002936122.1.42735 WP_002936122.1.4278 WP_002936122.1.42784 WP_002936122.1.42840 WP_002936122.1.4291 WP_002936122.1.43193 WP_002936122.1.43264 WP_002936122.1.43288 WP_002936122.1.43482 WP_002936122.1.43813 WP_002936122.1.43922 WP_002936122.1.43929 WP_002936122.1.43963 WP_002936122.1.43977 WP_002936122.1.44047 WP_002936122.1.44128 WP_002936122.1.44134 WP_002936122.1.44200 WP_002936122.1.44378 WP_002936122.1.44592 WP_002936122.1.44612 WP_002936122.1.44676 WP_002936122.1.44778 WP_002936122.1.4480 WP_002936122.1.45088 WP_002936122.1.45216 WP_002936122.1.45219 WP_002936122.1.45278 WP_002936122.1.4529 WP_002936122.1.45345 WP_002936122.1.45831 WP_002936122.1.45864 WP_002936122.1.45936 WP_002936122.1.467 WP_002936122.1.46880 WP_002936122.1.47108 WP_002936122.1.47119 WP_002936122.1.47315 WP_002936122.1.47421 WP_002936122.1.47434 WP_002936122.1.47449 WP_002936122.1.4748 WP_002936122.1.4757 WP_002936122.1.47643 WP_002936122.1.47745 WP_002936122.1.47869 WP_002936122.1.47892 WP_002936122.1.47894 WP_002936122.1.47900 WP_002936122.1.48076 WP_002936122.1.48167 WP_002936122.1.48217 WP_002936122.1.48397 WP_002936122.1.4858 WP_002936122.1.48583 WP_002936122.1.48603 WP_002936122.1.48616 WP_002936122.1.49093 WP_002936122.1.49099 WP_002936122.1.49206 WP_002936122.1.49255 WP_002936122.1.49368 WP_002936122.1.49413 WP_002936122.1.49509 WP_002936122.1.49782 WP_002936122.1.49968 WP_002936122.1.50047 WP_002936122.1.50127 WP_002936122.1.50188 WP_002936122.1.5021 WP_002936122.1.50437 WP_002936122.1.50538 WP_002936122.1.50551 WP_002936122.1.50635 WP_002936122.1.50675 WP_002936122.1.50751 WP_002936122.1.5079 WP_002936122.1.50798 WP_002936122.1.51052 WP_002936122.1.51155 WP_002936122.1.51263 WP_002936122.1.51386 WP_002936122.1.51551 WP_002936122.1.52159 WP_002936122.1.52175 WP_002936122.1.52490 WP_002936122.1.52559 WP_002936122.1.52599 WP_002936122.1.52628 WP_002936122.1.52798 WP_002936122.1.53030 WP_002936122.1.53174 WP_002936122.1.53290 WP_002936122.1.53309 WP_002936122.1.53344 WP_002936122.1.534 WP_002936122.1.53412 WP_002936122.1.5344 WP_002936122.1.53448 WP_002936122.1.53487 WP_002936122.1.53749 WP_002936122.1.53805 WP_002936122.1.53872 WP_002936122.1.53918 WP_002936122.1.54000 WP_002936122.1.5404 WP_002936122.1.54184 WP_002936122.1.54343 WP_002936122.1.54384 WP_002936122.1.54488 WP_002936122.1.54535 WP_002936122.1.54683 WP_002936122.1.54800 WP_002936122.1.54828 WP_002936122.1.55064 WP_002936122.1.5509 WP_002936122.1.55137 WP_002936122.1.55158 WP_002936122.1.55319 WP_002936122.1.55649 WP_002936122.1.55687 WP_002936122.1.55707 WP_002936122.1.55714 WP_002936122.1.5579 WP_002936122.1.55815 WP_002936122.1.55833 WP_002936122.1.55834 WP_002936122.1.55864 WP_002936122.1.55975 WP_002936122.1.56077 WP_002936122.1.56140 WP_002936122.1.56150 WP_002936122.1.56215 WP_002936122.1.56434 WP_002936122.1.56463 WP_002936122.1.56719 WP_002936122.1.56762 WP_002936122.1.56848 WP_002936122.1.57006 WP_002936122.1.57067 WP_002936122.1.5714 WP_002936122.1.57164 WP_002936122.1.57189 WP_002936122.1.57286 WP_002936122.1.57294 WP_002936122.1.5754 WP_002936122.1.57640 WP_002936122.1.57674 WP_002936122.1.57810 WP_002936122.1.58077 WP_002936122.1.58229 WP_002936122.1.58281 WP_002936122.1.58517 WP_002936122.1.58566 WP_002936122.1.58706 WP_002936122.1.58725 WP_002936122.1.58746 WP_002936122.1.58793 WP_002936122.1.58903 WP_002936122.1.58933 WP_002936122.1.5894 WP_002936122.1.59071 WP_002936122.1.59138 WP_002936122.1.59144 WP_002936122.1.59283 WP_002936122.1.59349 WP_002936122.1.5936 WP_002936122.1.59524 WP_002936122.1.59702 WP_002936122.1.5974 WP_002936122.1.59929 WP_002936122.1.60184 WP_002936122.1.60233 WP_002936122.1.60237 WP_002936122.1.60293 WP_002936122.1.60377 WP_002936122.1.60445 WP_002936122.1.60658 WP_002936122.1.6071 WP_002936122.1.60853 WP_002936122.1.60862 WP_002936122.1.609 WP_002936122.1.61024 WP_002936122.1.61034 WP_002936122.1.61094 WP_002936122.1.61397 WP_002936122.1.61415 WP_002936122.1.61533 WP_002936122.1.61540 WP_002936122.1.6156 WP_002936122.1.6165 WP_002936122.1.61715 WP_002936122.1.61721 WP_002936122.1.61782 WP_002936122.1.61885 WP_002936122.1.62112 WP_002936122.1.6223 WP_002936122.1.62268 WP_002936122.1.62485 WP_002936122.1.62497 WP_002936122.1.62587 WP_002936122.1.62710 WP_002936122.1.6272 WP_002936122.1.62743 WP_002936122.1.6278 WP_002936122.1.62805 WP_002936122.1.63018 WP_002936122.1.63168 WP_002936122.1.63174 WP_002936122.1.63318 WP_002936122.1.63653 WP_002936122.1.63685 WP_002936122.1.6377 WP_002936122.1.63815 WP_002936122.1.63959 WP_002936122.1.64009 WP_002936122.1.64120 WP_002936122.1.64128 WP_002936122.1.64273 WP_002936122.1.64281 WP_002936122.1.64384 WP_002936122.1.64641 WP_002936122.1.64797 WP_002936122.1.64952 WP_002936122.1.64997 WP_002936122.1.65024 WP_002936122.1.65047 WP_002936122.1.65090 WP_002936122.1.65161 WP_002936122.1.65184 WP_002936122.1.65314 WP_002936122.1.65422 WP_002936122.1.65458 WP_002936122.1.65905 WP_002936122.1.65911 WP_002936122.1.65917 WP_002936122.1.6596 WP_002936122.1.6605 WP_002936122.1.66185 WP_002936122.1.66186 WP_002936122.1.66300 WP_002936122.1.66347 WP_002936122.1.66472 WP_002936122.1.66521 WP_002936122.1.66590 WP_002936122.1.66609 WP_002936122.1.66707 WP_002936122.1.6686 WP_002936122.1.6690 WP_002936122.1.66954 WP_002936122.1.67058 WP_002936122.1.67109 WP_002936122.1.6711 WP_002936122.1.67338 WP_002936122.1.67488 WP_002936122.1.6758 WP_002936122.1.677 WP_002936122.1.67883 WP_002936122.1.67958 WP_002936122.1.67962 WP_002936122.1.68010 WP_002936122.1.683 WP_002936122.1.68303 WP_002936122.1.68602 WP_002936122.1.68666 WP_002936122.1.68739 WP_002936122.1.68791 WP_002936122.1.68941 WP_002936122.1.69056 WP_002936122.1.69115 WP_002936122.1.69161 WP_002936122.1.69167 WP_002936122.1.69413 WP_002936122.1.69454 WP_002936122.1.6967 WP_002936122.1.69698 WP_002936122.1.69706 WP_002936122.1.69806 WP_002936122.1.69922 WP_002936122.1.70033 WP_002936122.1.70102 WP_002936122.1.70257 WP_002936122.1.70301 WP_002936122.1.70310 WP_002936122.1.70387 WP_002936122.1.70390 WP_002936122.1.70403 WP_002936122.1.70484 WP_002936122.1.70817 WP_002936122.1.70832 WP_002936122.1.70997 WP_002936122.1.71125 WP_002936122.1.71140 WP_002936122.1.71425 WP_002936122.1.71432 WP_002936122.1.71462 WP_002936122.1.71498 WP_002936122.1.71727 WP_002936122.1.71911 WP_002936122.1.71914 WP_002936122.1.72030 WP_002936122.1.72174 WP_002936122.1.72185 WP_002936122.1.72247 WP_002936122.1.72296 WP_002936122.1.72413 WP_002936122.1.7257 WP_002936122.1.72611 WP_002936122.1.72924 WP_002936122.1.73011 WP_002936122.1.73262 WP_002936122.1.73272 WP_002936122.1.73280 WP_002936122.1.73299 WP_002936122.1.7342 WP_002936122.1.73679 WP_002936122.1.73721 WP_002936122.1.73905 WP_002936122.1.74090 WP_002936122.1.74132 WP_002936122.1.74368 WP_002936122.1.74554 WP_002936122.1.74567 WP_002936122.1.74843 WP_002936122.1.74865 WP_002936122.1.75028 WP_002936122.1.75229 WP_002936122.1.7537 WP_002936122.1.75605 WP_002936122.1.75643 WP_002936122.1.75930 WP_002936122.1.75965 WP_002936122.1.75985 WP_002936122.1.76083 WP_002936122.1.76175 WP_002936122.1.76400 WP_002936122.1.76666 WP_002936122.1.76735 WP_002936122.1.76808 WP_002936122.1.76811 WP_002936122.1.76907 WP_002936122.1.77006 WP_002936122.1.77026 WP_002936122.1.7739 WP_002936122.1.7754 WP_002936122.1.77616 WP_002936122.1.77624 WP_002936122.1.7763 WP_002936122.1.77752 WP_002936122.1.77781 WP_002936122.1.77795 WP_002936122.1.77958 WP_002936122.1.78021 WP_002936122.1.78138 WP_002936122.1.78316 WP_002936122.1.78326 WP_002936122.1.7873 WP_002936122.1.78744 WP_002936122.1.78792 WP_002936122.1.7884 WP_002936122.1.78883 WP_002936122.1.7889 WP_002936122.1.78901 WP_002936122.1.78945 WP_002936122.1.79054 WP_002936122.1.79154 WP_002936122.1.79162 WP_002936122.1.79499 WP_002936122.1.79610 WP_002936122.1.79644 WP_002936122.1.79846 WP_002936122.1.79901 WP_002936122.1.80025 WP_002936122.1.80097 WP_002936122.1.80131 WP_002936122.1.80153 WP_002936122.1.80216 WP_002936122.1.80235 WP_002936122.1.80418 WP_002936122.1.8061 WP_002936122.1.80716 WP_002936122.1.80742 WP_002936122.1.80787 WP_002936122.1.8083 WP_002936122.1.81103 WP_002936122.1.81332 WP_002936122.1.81370 WP_002936122.1.81372 WP_002936122.1.81513 WP_002936122.1.81584 WP_002936122.1.81705 WP_002936122.1.82122 WP_002936122.1.82418 WP_002936122.1.8251 WP_002936122.1.82695 WP_002936122.1.82772 WP_002936122.1.82830 WP_002936122.1.82870 WP_002936122.1.82894 WP_002936122.1.82977 WP_002936122.1.83058 WP_002936122.1.83087 WP_002936122.1.83279 WP_002936122.1.8344 WP_002936122.1.83915 WP_002936122.1.8414 WP_002936122.1.8422 WP_002936122.1.84389 WP_002936122.1.84412 WP_002936122.1.84489 WP_002936122.1.84535 WP_002936122.1.85051 WP_002936122.1.85075 WP_002936122.1.8514 WP_002936122.1.85327 WP_002936122.1.85333 WP_002936122.1.85437 WP_002936122.1.85450 WP_002936122.1.85513 WP_002936122.1.85908 WP_002936122.1.86151 WP_002936122.1.86177 WP_002936122.1.86639 WP_002936122.1.86817 WP_002936122.1.86830 WP_002936122.1.86836 WP_002936122.1.86842 WP_002936122.1.86886 WP_002936122.1.87005 WP_002936122.1.87044 WP_002936122.1.87321 WP_002936122.1.87344 WP_002936122.1.87405 WP_002936122.1.87438 WP_002936122.1.87819 WP_002936122.1.87885 WP_002936122.1.8790 WP_002936122.1.88173 WP_002936122.1.88201 WP_002936122.1.88233 WP_002936122.1.88543 WP_002936122.1.88575 WP_002936122.1.88626 WP_002936122.1.88635 WP_002936122.1.88653 WP_002936122.1.88779 WP_002936122.1.88787 WP_002936122.1.88882 WP_002936122.1.88972 WP_002936122.1.89037 WP_002936122.1.89038 WP_002936122.1.89056 WP_002936122.1.89279 WP_002936122.1.89358 WP_002936122.1.89388 WP_002936122.1.89800 WP_002936122.1.8993 WP_002936122.1.89981 WP_002936122.1.89989 WP_002936122.1.90172 WP_002936122.1.90634 WP_002936122.1.90742 WP_002936122.1.90961 WP_002936122.1.91004 WP_002936122.1.91238 WP_002936122.1.91387 WP_002936122.1.91636 WP_002936122.1.91792 WP_002936122.1.91865 WP_002936122.1.91912 WP_002936122.1.91973 WP_002936122.1.91983 WP_002936122.1.92134 WP_002936122.1.92263 WP_002936122.1.92441 WP_002936122.1.92554 WP_002936122.1.92584 WP_002936122.1.92692 WP_002936122.1.92722 WP_002936122.1.928 WP_002936122.1.92964 WP_002936122.1.93190 WP_002936122.1.93220 WP_002936122.1.93456 WP_002936122.1.93510 WP_002936122.1.93519 WP_002936122.1.9361 WP_002936122.1.93627 WP_002936122.1.93646 WP_002936122.1.9376 WP_002936122.1.93771 WP_002936122.1.93914 WP_002936122.1.94291 WP_002936122.1.94332 WP_002936122.1.94338 WP_002936122.1.94418 WP_002936122.1.94419 WP_002936122.1.94449 WP_002936122.1.9454 WP_002936122.1.94587 WP_002936122.1.94639 WP_002936122.1.94780 WP_002936122.1.94786 WP_002936122.1.94945 WP_002936122.1.95180 WP_002936122.1.95213 WP_002936122.1.95214 WP_002936122.1.95262 WP_002936122.1.95288 WP_002936122.1.95351 WP_002936122.1.95387 WP_002936122.1.95472 WP_002936122.1.95542 WP_002936122.1.95788 WP_002936122.1.95798 WP_002936122.1.96021 WP_002936122.1.96164 WP_002936122.1.96282 WP_002936122.1.96427 WP_002936122.1.96451 WP_002936122.1.9652 WP_002936122.1.96524 WP_002936122.1.96574 WP_002936122.1.96700 WP_002936122.1.96717 WP_002936122.1.96973 WP_002936122.1.97052 WP_002936122.1.97453 WP_002936122.1.97493 WP_002936122.1.97504 WP_002936122.1.97506 WP_002936122.1.97515 WP_002936122.1.97554 WP_002936122.1.97722 WP_002936122.1.97814 WP_002936122.1.97857 WP_002936122.1.9809 WP_002936122.1.9815 WP_002936122.1.98253 WP_002936122.1.98271 WP_002936122.1.98326 WP_002936122.1.98343 WP_002936122.1.98406 WP_002936122.1.98416 WP_002936122.1.98431 WP_002936122.1.98464 WP_002936122.1.98860 WP_002936122.1.98864 WP_002936122.1.98889 WP_002936122.1.98921 WP_002936122.1.98999 WP_002936122.1.99127 WP_002936122.1.9922 WP_002936122.1.99252 WP_002936122.1.99324 WP_002936122.1.9956 WP_002936122.1.99664 WP_002936122.1.99696 WP_002936122.1.99988 YP_003029670.1.79686 gi|386578932|ref|YP_006075338.1| gi|253754597|ref|YP_003027738.1| gi|386587211|ref|YP_006083613.1| gi|403062537|ref|YP_006650753.1| gi|476420901|ref|YP_007571897.1| gi|499144217|ref|YP_007976281.1| gi|386589204|ref|YP_006085605.1| gi|330833740|ref|YP_004402565.1| 218494.SSU1919 391295.SSU05_2137 391296.SSU98_2139 568813.SSUSC84_1937 568814.SSUBM407_1984 gi|389857645|ref|YP_006359888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]