SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000138 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000138
Domain Number 1 Region: 25-488
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-91
Family ALDH-like 0.00000274
Further Details:      
 
Domain Number 2 Region: 503-767
Classification Level Classification E-value
Superfamily ALDH-like 7.2e-41
Family ALDH-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000138   Gene: ENSCJAG00000000074   Transcript: ENSCJAT00000000146
Sequence length 799
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:41329422:41348443:1 gene:ENSCJAG00000000074 transcript:ENSCJAT00000000146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRAAPHARELFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSLPCQ
DPITGESLASCLQAQAEDVAAAVEAARMAFKSWSAQPGVIRGQHLTRLAKVIQKHQRLLW
TLESLVTGRVVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMVGVIGLILPPTFSF
LELMWRICPALAVGCTVVALVPPASPTPLLLAQLAGELGSFPGILNVISGPASLGPILAT
QPAIQKVAFCGALEEGRVLRRSLAGECVELGLALGMESLLLLTDTADMDSAAEGVVDAAW
SDRGPGGLRLLIQESVWDEFMRRLQERMGRLRSGRGLDGAVDMGTRGAAACDLAQRFVHE
AQSQGAQVFQAGDVPPKRPFYPPTLVSNLPPASPCAQAEVPWPVVVASPFRTAKEALAVA
NGTPRGGSASVWSERLGQALELGYGLQMGTVWINAHGLRDPSVPTGGCKESGCSWHGGPD
GLYEYLRPSRTPTQVCCLSKNMSYDTFGLAVPSTLPAGPEIGPSPAPPYGLFIGGRFQAP
GARSSRPIWDSSGNLHGYVAEGGAKDIRGAVEAAHQASPGWAGQSPGARAGLLWALAAAL
ERRKSTLASRLERQGVELKTAEVEVELSARRLRAWGARAQAQGHTLQVSGLRGPVLRLRE
PLGVLAVVCPDEWPLLAFVSLLAPALACGNTVVMVPSAACPLLALEVCQDMATLFTAGLA
NVVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWAAGNFKPVWVSGCSRAWDQEAEG
GPELGLKAARPRPMAAMGT
Download sequence
Identical sequences F7EJF1
ENSCJAP00000000141 ENSCJAP00000000138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]