SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000427 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000427
Domain Number 1 Region: 120-232
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000029
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000427   Gene: ENSCJAG00000000249   Transcript: ENSCJAT00000000461
Sequence length 233
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:38385772:38545258:-1 gene:ENSCJAG00000000249 transcript:ENSCJAT00000000461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEEKEVDPGKEGPNSPQSKPPEPPVINEYADAQLHNLVKRMRQRTAIYKKKLVEGDLSS
PEASPKTAKPTAVPAVKESDKPTEEHYYRLLCFKVKKMPLTEYLKQLKLPESIDSYTDQL
YLLWLLLVTLAYNWNCWFIPLRLVFPYQTPDNIHYWLIVDIICDIIYLYDILLIQPRIQF
IRGGDIIVDSNELRKHYRSSTKFQLDVASIIPFDVCYLFFGFNPIFRANRMLK
Download sequence
Identical sequences F7G1F2
ENSCJAP00000000427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]