SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000610 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000610
Domain Number 1 Region: 30-116
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.7e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000745
Further Details:      
 
Domain Number 2 Region: 107-178
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.37e-16
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000610   Gene: ENSCJAG00000000365   Transcript: ENSCJAT00000000657
Sequence length 183
Comment pep:novel chromosome:C_jacchus3.2.1:X:50028401:50028949:-1 gene:ENSCJAG00000000365 transcript:ENSCJAT00000000657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWLFQLSAQRRPRYNFLQSSRIRVHLTPAASTMPPKFDPNEIKVVYLRCTGGEVGATSAL
APKIGPLGLSPKKVGDDIAKATVDWKGLRITVKLTIQNRQAQIEVVPSASALIIKAPKEP
LRDRKKQKNIKHSGNITFDEIVDIARQMWHRSLAGELSGTIKEILGNAQSVGCNVDGRHT
HDI
Download sequence
Identical sequences F6QLQ0
ENSCJAP00000000610 ENSCJAP00000000610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]