SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000627 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000627
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.55e-83
Family Carbonic anhydrase 0.00000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000627   Gene: ENSCJAG00000000373   Transcript: ENSCJAT00000000674
Sequence length 255
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:37349348:37361694:-1 gene:ENSCJAG00000000373 transcript:ENSCJAT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDWGYDGKNGPEQWGKLYPIANGNNQFPIDIKTSEAKHDTFLKPLSYKPATAKEIIN
VGHSFHVNFEDNDNQLVVKGGPLSNSYRLHQLHFHRDSGSEHTVDGFKYSGELHIVHWNP
EKYSSLAEAISEADALAVIGVLLKVGEANPKLQKVLDALHAIKTKGKQAPFTNFDPSTLP
SSLNFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRALLSNVEGDNPVPIQHNYP
TQPVKGRTVRASFCH
Download sequence
Identical sequences F6QLE4
ENSCJAP00000042783 ENSCJAP00000000627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]