SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000634 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000634
Domain Number 1 Region: 22-88
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.93e-16
Family Carbonic anhydrase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000634   Gene: ENSCJAG00000000376   Transcript: ENSCJAT00000000681
Sequence length 158
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:43403665:43409669:1 gene:ENSCJAG00000000376 transcript:ENSCJAT00000000681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVPLLSLFLLGGQAQHGSDWTYSEGALDEAHWPKYYPHCGGQRQSPIDLQRTKVRYN
PALKGLNLTGYESQVGEFLMVNNGHTAWAGGIFLPSLSSACGEGVKHKGQRQWLCSPSLD
RAEGSEDGISKEEKSPACHRACSGSLLPISRAVLKSLW
Download sequence
Identical sequences F6QL01
ENSCJAP00000000634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]