SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000665 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000665
Domain Number 1 Region: 173-371
Classification Level Classification E-value
Superfamily E set domains 3.92e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 71-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000665   Gene: ENSCJAG00000000396   Transcript: ENSCJAT00000000712
Sequence length 436
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:40379901:40392899:1 gene:ENSCJAG00000000396 transcript:ENSCJAT00000000712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLARALRRLSGVLDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDEAEGGNGEETEDGA
TSPRVLTPTLTLTLPP
Download sequence
Identical sequences F6Q9X4
ENSCJAP00000000665 XP_002762370.1.60252 ENSCJAP00000000665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]