SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000674 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000674
Domain Number 1 Region: 45-200
Classification Level Classification E-value
Superfamily L domain-like 3.16e-31
Family Internalin LRR domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000000674
Domain Number - Region: 848-951
Classification Level Classification E-value
Superfamily Urocanase 0.0942
Family Urocanase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000674   Gene: ENSCJAG00000000393   Transcript: ENSCJAT00000000722
Sequence length 1027
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:37119793:37161683:1 gene:ENSCJAG00000000393 transcript:ENSCJAT00000000722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVEAEVENEDWDSSCGDVCFMDKGLRSISELSLGSTLHAISLHCNNISKIEAIDHIW
NLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITKIEGLEELINLARLNLSYNQINDLS
GLIPLHGIKHKLRYIDLHSNCIDSIHHLLRCTVGLHFLTNLILEKDGDDNPVCRLPGYRA
IILQTLPQLRILDGKNIFGEPVNLTEINSSQMQCLEGLLDNLVSSESPINISEDEIIGRM
PVVTAPIDELAPLEEFASTPRDAALTSLISVCPSSETEKIHHESNLQNEIKLQKLDDQIL
QLRNETSNSTDNVPEKDPRPKRDTDITSESDYGNRKECNRKVPRRSKIPYYPKTIQTIKH
HNKNYNSFVSCNRKMKPPYLKELYVSSSLANCHMLQESEKPKTEIIKVEKSTSEDNTYRS
LIEQLDQEREKRWRAEQAEKKLMDYIDELHKHANKKDDMHSLALLTTDRLKEIIFKERNS
KGQLEVMVHKLQNEIKKLTIELMKAKDQQEDHLKHLGTLEKTLEEMERQKRQQQVAQIKL
IQEVELKASAADKEIYLLRTSLHQEREQVQQLHELLALKEQEHRKELETRKFVTDTEFQD
ALAKEMAKEDKKHEQVINEYQEKIDVLNQQYMDLENEFRVALTVEARRFQDVKDGFENVA
TELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQINTLE
ILIEDDKEKSIQIELLKHEKVQLISELAAKDSLILGLRTERKVWGHELAKQGSSLAQNRG
KLEAQIESLSRENECLRKTNESDSDALRIKCKIIEDQTETIRKLKDCLQEKDEHIKRLQE
KITEIEKCTQEQLDEKSAQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAYSTLNQ
KWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAFKKQVD
AIVEAHQAEIAHLANEKQKCIDSANLKIHQIEEEMRELLEETCKNKKTMEAKIKQLAFAL
NEIQQDM
Download sequence
Identical sequences F6PZ78
ENSCJAP00000000674 ENSCJAP00000000674 XP_002759084.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]