SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000718 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000718
Domain Number 1 Region: 58-117
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000144
Family AN1-like Zinc finger 0.0000556
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000392
Family AN1-like Zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000718   Gene: ENSCJAG00000000421   Transcript: ENSCJAT00000000768
Sequence length 268
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:33730784:33751369:-1 gene:ENSCJAG00000000421 transcript:ENSCJAT00000000768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDIGQHCQVEHCRQRDFLPFVCGDCSGIFCLEHRSKESHGCPEVTVSNERLKTDQHT
SYPCSFKDCAERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPHMAATQKLVKDIID
SKTGETASKRRKGAKNSETAAKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKP
MFFCHRWSIGKAIDFAASLASLKNDNNKLTAKKLRLCHITSGEALPLDHTLETWIAKEDC
PLYNGGNIILEYLNDEEQFCKNVESYLE
Download sequence
Identical sequences F6SE90
XP_002759080.1.60252 ENSCJAP00000043093 ENSCJAP00000000718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]