SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000735 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000735
Domain Number 1 Region: 335-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.15e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000000735
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0558
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000735   Gene: ENSCJAG00000000428   Transcript: ENSCJAT00000000785
Sequence length 1254
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:154785647:154863969:-1 gene:ENSCJAG00000000428 transcript:ENSCJAT00000000785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPSSPSNPTKEPMEPQPSQVPLPEDMDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDTHQSPDAFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKASEEYYQLLMSSEGHPCGADVPSYTVEEIES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPSWSVCSGADSFTQECCMEEKSFFCRVSVGKSHENEIRYHPFRMTPYLVKVR
GRQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQ
DLTETSVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFIN
PWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKPLHPSMQELTEQIHRLLLQPVPHSGS
SGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRQRRVEICKNGNKTKNRSHYSHESGEQKKK
PVTEMQTSPPAEMKAVPAVEKDSVGASFPEELACREQPTCSYQQISCLDGVIRYLESCSE
ASTLKRKCEFPANVPTLRSGDKRKATVSPGLRAAEAELPSRVNSRTGVGTHLTSLALPSK
AESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDRLVGPALACGLNQEKEP
FKNLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSILQSHCHYYLQERSKGQPSERTTPGLR
SASGMDSPWKKAGKNRKLKSKRLKPRDSSESTGSGGPVPARPPLMGLNTTAWSPSDTSQS
SCPAMPFPTPVPAYSLPVFPAPGTVAAPPMPPHASFPVSAVPVDLQHQLAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPHFPSHPTLTSEMAPASQPEFPSRTSVPRQPC
TCPATRASPSAVGRASPPLFQSRCSSPLQLNLLQLEEAPEGGTGAVGTTGATETAAVGPD
CKPGTSRDQQPTAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSNS
LGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAEMNTGLEESERFIKCVLQDPIWLLMA
DADSRVMMTYQLPSRNSEAVLKEDREKLKLLQKLQPRFTESQKQELREVHTWMQTSGLPA
ALDVAECVYCENKEKGNMCIPYEEDIPSLGLSEVSDTKEDENGSSLNHKIEKQT
Download sequence
Identical sequences F6SDM4
XP_008998019.1.60252 XP_008998020.1.60252 ENSCJAP00000000735 ENSCJAP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]