SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000783 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000783
Domain Number 1 Region: 165-284
Classification Level Classification E-value
Superfamily POZ domain 2.55e-28
Family BTB/POZ domain 0.0005
Further Details:      
 
Domain Number 2 Region: 556-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000557
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000783   Gene: ENSCJAG00000000454   Transcript: ENSCJAT00000000836
Sequence length 694
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:32556336:32593332:1 gene:ENSCJAG00000000454 transcript:ENSCJAT00000000836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDGASLSDSTEDEEEGASLGDGSGAEGGSCSSSRRSGGDGGDEVEGSGMGAGEGETVQH
FPLARPKSLMQKLQSSFQASWLKDFPWLRYSRDTGLMSCGWCQKTPADGGSVDLPQVGHD
ELSRGTRNYKKTLLLRHHVSNEHKLNANAQEESEEGYCDFNSRPHENSYCYQLLRQLDEQ
RKQDILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCASDKEKPKQNNTTHLDIAAVQGF
SVILDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVV
DYNNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNESS
WVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLE
DCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPDVDRNVNANLLAEAGTSQDGGDAGTSH
DFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGASNDFKYGLLPESWPKQETWENGESSL
IMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSLVHKKDKK
YKCMVCKKIFMLAASVGIRHGSRRYGVCVDCADKSQPGGQEGVDQGQDTEFPRDEEYEEN
EVGEADEELVDDGEDQNDPSRWDESGEVCMSLDD
Download sequence
Identical sequences F6RR90
ENSCJAP00000000783 ENSCJAP00000000778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]