SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000785 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000785
Domain Number 1 Region: 54-414
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.92e-26
Family L-arabinose binding protein-like 0.006
Further Details:      
 
Domain Number 2 Region: 420-449,482-572
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.71e-21
Family Phosphate binding protein-like 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000785   Gene: ENSCJAG00000000450   Transcript: ENSCJAT00000000838
Sequence length 577
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:40314484:40332901:1 gene:ENSCJAG00000000450 transcript:ENSCJAT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGASGPGGVPGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPLLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPAPPPEK
TLCKGFCIDILKRLAQDHRLQAMTSYLVNGKHGKKIDGVWKGMIGKVFYQRADMAIGSLT
INEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFL
Download sequence
Identical sequences F6RR53
ENSCJAP00000000785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]