SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001009 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001009
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily POZ domain 7.25e-38
Family BTB/POZ domain 0.00000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001009   Gene: ENSCJAG00000000587   Transcript: ENSCJAT00000001071
Sequence length 112
Comment pep:novel chromosome:C_jacchus3.2.1:16:26393168:26426295:-1 gene:ENSCJAG00000000587 transcript:ENSCJAT00000001071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Download sequence
Identical sequences A0A024R7Y5 A0A0B8RTH2 A0A0D9RM37 A0A0E9WT96 A0A0P6JJ00 A0A0P7Z789 A0A0Q3X6W3 A0A151MN60 A0A1S3AQ64 A0A1S3G517 A0A1U7RJA2 A0A1U7UUB9 A0A1W7RCU1 A0A212CEP5 A0A218UPE1 A0A226NLZ2 A0A250Y932 A0A286XZN3 A0A2I0MWE7 A0A2I3NGA9 A0A2K5DBC4 A0A2K5L0V0 A0A2K5Q4Y1 A0A2K5WM01 A0A2K6C3D4 A0A2K6FDL3 A0A2K6M1Y2 A0A2K6PBR9 A0A2K6T9F2 B9EN56 C1BEZ0 C1BIJ8 C1C460 F2Z545 F7C1R4 F7D5C0 F8V3I9 G1NG91 G3H9C9 G3QIE4 G3W849 H2PQK8 I0FUL6 J3S8L6 J9P2H3 K7AZJ3 K7F7A1 M3YFM4 P83940 P83941 Q15369 Q28H26 Q2KII4 Q5ZJT7 Q6PHW7 T1D843 U3ETF7
1vcbB ENSSHAP00000011604 ENSMUSP00000111009 ENSSSCP00000006587 ENSPPYP00000020952 ENSSTOP00000022578 ENSCHOP00000009596 ENSDORP00000003419 ENSRNOP00000067410 ENSCHOP00000009596 ENSMMUP00000006823 ENSTTRP00000010938 ENSTTRP00000010938 ENSMGAP00000012085 ENSPANP00000004959 ENSMUSP00000111009 ENSMPUP00000010131 ENSECAP00000000044 ENSNLEP00000001913 ENSP00000284811 ENSP00000428074 ENSP00000428171 ENSP00000428334 ENSP00000429596 ENSP00000429906 ENSFCAP00000021916 gi|134026008|gb|AAI35464| gi|62858367|ref|NP_001016420| gi|89273855|gb|CAJ81641| 1vcb_B 1vcb_E 1vcb_H 1vcb_K ENSGALP00000025184 ENSMGAP00000012085 ENSMPUP00000010131 NP_001007889.1.86415 NP_001016420.1.99540 NP_001039958.1.59421 NP_001039958.1.76553 NP_001185606.1.72884 NP_001191786.1.87134 NP_001191786.1.92137 NP_001191787.1.87134 NP_001191787.1.92137 NP_001191788.1.87134 NP_001191788.1.92137 NP_001191789.1.87134 NP_001191789.1.92137 NP_001191790.1.87134 NP_001191790.1.92137 NP_001191791.1.87134 NP_001191791.1.92137 NP_001233156.1.62641 NP_001238934.1.37143 NP_001257490.1.100692 NP_001257490.1.4139 NP_001257491.1.100692 NP_001257491.1.4139 NP_001257492.1.100692 NP_001257492.1.4139 NP_005639.1.87134 NP_005639.1.92137 NP_072115.1.100692 NP_072115.1.4139 NP_080732.1.92730 XP_001493068.2.31192 XP_001927356.3.46622 XP_002199345.1.42559 XP_002759151.1.60252 XP_003205177.1.16129 XP_003219628.1.98722 XP_003269482.1.23891 XP_003269484.1.23891 XP_003269485.1.23891 XP_003269486.1.23891 XP_003269488.1.23891 XP_003269491.1.23891 XP_003269492.1.23891 XP_003355080.1.46622 XP_003365628.1.31192 XP_003408273.1.64505 XP_003479969.2.53824 XP_003500770.1.69978 XP_003759749.1.9362 XP_003831355.1.60992 XP_003831357.1.60992 XP_003831361.1.60992 XP_004011792.1.66739 XP_004011793.1.66739 XP_004280612.1.21590 XP_004280613.1.21590 XP_004372577.1.4749 XP_004372578.1.4749 XP_004403953.1.74151 XP_004403954.1.74151 XP_004436347.1.5094 XP_004436348.1.5094 XP_004462524.1.11602 XP_004462525.1.11602 XP_004462526.1.11602 XP_004462527.1.11602 XP_004602444.1.94378 XP_004637612.1.9945 XP_004679850.1.23501 XP_004762394.1.14098 XP_004762395.1.14098 XP_004842106.1.39548 XP_005021267.1.99704 XP_005042248.1.66865 XP_005150867.1.78019 XP_005215584.1.76553 XP_005215585.1.76553 XP_005229944.1.75256 XP_005306839.1.60341 XP_005306840.1.60341 XP_005335889.1.77405 XP_005335890.1.77405 XP_005361922.1.66349 XP_005361923.1.66349 XP_005371867.1.66349 XP_005392136.1.28644 XP_005392137.1.28644 XP_005430847.1.5688 XP_005443244.1.10750 XP_005479433.1.73095 XP_005479434.1.73095 XP_005479435.1.73095 XP_005509270.1.63277 XP_005517144.1.90289 XP_005563607.1.63531 XP_005563608.1.63531 XP_005563609.1.63531 XP_005613108.1.31192 XP_005638106.1.84170 XP_005689129.1.57651 XP_005907573.1.15283 XP_005967298.1.78601 XP_005967299.1.78601 XP_005967300.1.78601 XP_006015354.1.24877 XP_006015355.1.24877 XP_006015356.1.24877 XP_006054260.1.26621 XP_006054261.1.26621 XP_006086412.1.53796 XP_006086413.1.53796 XP_006086414.1.53796 XP_006131606.1.96668 XP_006139868.1.99106 XP_006139869.1.99106 XP_006185919.1.101512 XP_006202468.1.17985 XP_006202469.1.17985 XP_006237786.1.100692 XP_006495624.1.92730 XP_006495625.1.92730 XP_006495626.1.92730 XP_006495627.1.92730 XP_006767395.1.95426 XP_006767396.1.95426 XP_006767397.1.95426 XP_006860069.1.41390 XP_006880534.1.29581 XP_006924096.1.64745 XP_006924097.1.64745 XP_007063630.1.26238 XP_007080418.1.5354 XP_007080419.1.5354 XP_007116509.1.24612 XP_007116510.1.24612 XP_007116511.1.24612 XP_007116512.1.24612 XP_007116513.1.24612 XP_007116514.1.24612 XP_007185122.1.59432 XP_007185123.1.59432 XP_007185124.1.59432 XP_007439978.1.37977 XP_007439979.1.37977 XP_007453771.1.90284 XP_007487010.1.35504 XP_007487011.1.35504 XP_007487012.1.35504 XP_007538827.2.11023 XP_007635785.1.28591 XP_007635786.1.28591 XP_007954950.1.48129 XP_007999091.1.81039 XP_007999092.1.81039 XP_007999093.1.81039 XP_007999094.1.81039 XP_008068951.1.4292 XP_008068952.1.4292 XP_008068953.1.4292 XP_008106805.1.98722 XP_008163525.1.60341 XP_008490538.1.100939 XP_008539471.1.77740 XP_008539472.1.77740 XP_008539473.1.77740 XP_008577113.1.73410 XP_008577122.1.73410 XP_008629589.1.15636 XP_008709032.1.72690 XP_008847118.1.79516 XP_008930437.1.96775 XP_008945764.1.37566 XP_008954927.1.60992 XP_008954928.1.60992 XP_009074223.1.14518 XP_009084352.1.15306 XP_009242143.1.23681 XP_009242144.1.23681 XP_009242146.1.23681 XP_009242147.1.23681 XP_009242148.1.23681 XP_009242149.1.23681 XP_009242150.1.23681 XP_009242151.1.23681 XP_009242152.1.23681 XP_009242153.1.23681 XP_009242154.1.23681 XP_009242155.1.23681 XP_009270920.1.47732 XP_009333298.1.49731 XP_009467272.1.38621 XP_009490711.1.14425 XP_009498595.1.22320 XP_009569207.1.62272 XP_009576978.1.87690 XP_009632785.1.23211 XP_009687771.1.43253 XP_009687772.1.43253 XP_009704962.1.71050 XP_009811067.1.37116 XP_009866876.1.31609 XP_009890197.1.48241 XP_009914508.1.2804 XP_009938813.1.35112 XP_009954426.1.99599 XP_009972007.1.75343 XP_009987890.1.11325 XP_009993878.1.85724 XP_010009741.1.70042 XP_010082136.1.40768 XP_010134867.1.100080 XP_010145693.1.22856 XP_010192889.1.17318 XP_010201675.1.23224 XP_010283074.1.48707 XP_010298550.1.13389 XP_010349730.1.74449 XP_010349731.1.74449 XP_010349732.1.74449 XP_010364293.1.97406 XP_010364294.1.97406 XP_010364295.1.97406 XP_010364296.1.97406 XP_010364297.1.97406 XP_010364298.1.97406 XP_010403383.1.2935 XP_010574178.1.12557 XP_010574179.1.12557 XP_010574180.1.12557 XP_010586657.1.64505 XP_010586658.1.64505 XP_010620717.1.5607 XP_010620719.1.5607 XP_010620720.1.5607 XP_010845244.1.44457 XP_010845245.1.44457 XP_010949743.1.22495 XP_010949751.1.22495 XP_010977722.1.51371 XP_010977723.1.51371 XP_011365241.1.92234 XP_011365242.1.92234 XP_011515882.1.92137 XP_011515883.1.92137 XP_011582051.1.59079 XP_011742776.1.29376 XP_011742777.1.29376 XP_011742778.1.29376 XP_011742779.1.29376 XP_011742780.1.29376 XP_011742781.1.29376 XP_011837378.1.47321 XP_011837379.1.47321 XP_011837380.1.47321 XP_011837381.1.47321 XP_011837382.1.47321 XP_011837383.1.47321 XP_011837384.1.47321 XP_011912844.1.92194 XP_011914193.1.92194 XP_011914194.1.92194 XP_011914195.1.92194 XP_011914196.1.92194 XP_011969986.1.54773 XP_011974638.1.54773 XP_011974639.1.54773 XP_012306329.1.9421 XP_012306330.1.9421 XP_012306331.1.9421 XP_012370318.1.9945 XP_012396712.1.9362 XP_012518640.1.63892 XP_012590817.1.48125 XP_012671644.1.3086 XP_012820153.1.99540 XP_012820154.1.99540 XP_012883906.1.60039 XP_012916844.1.14098 XP_012916845.1.14098 XP_012926672.1.39548 XP_013027910.1.65836 XP_013798316.1.3284 XP_013908605.1.67126 XP_013908606.1.67126 XP_013908607.1.67126 XP_014037304.1.97760 XP_014201454.1.60992 XP_014337575.1.15283 XP_014337576.1.15283 XP_014433252.1.96668 XP_014445341.1.99106 XP_014462350.1.47583 XP_014709234.1.49734 XP_014709235.1.49734 XP_014739014.1.99236 XP_014739015.1.99236 XP_014807415.1.91963 XP_014920211.1.86478 XP_014920212.1.86478 XP_015000999.1.72884 XP_015001000.1.72884 XP_015001001.1.72884 XP_015271684.1.55130 XP_015271685.1.55130 XP_015271686.1.55130 XP_015310463.1.63531 XP_015310464.1.63531 XP_015335152.1.40921 XP_015341360.1.40921 XP_015341361.1.40921 XP_015361677.1.40921 XP_015473744.1.82291 XP_015682125.1.16292 XP_015711281.1.68032 XP_016009184.1.101085 XP_016009185.1.101085 XP_016009186.1.101085 XP_016009187.1.101085 XP_016071562.1.3490 XP_016071563.1.3490 XP_016087553.1.42290 XP_016087554.1.42290 XP_016126445.1.42290 XP_016152277.1.66865 XP_016310042.1.79318 XP_016310043.1.79318 XP_016338326.1.79318 XP_016338327.1.79318 XP_016399434.1.44103 XP_016399435.1.44103 XP_016422535.1.44103 XP_016422536.1.44103 XP_016422537.1.44103 XP_016801025.1.37143 XP_016814388.1.37143 XP_016814389.1.37143 XP_016814390.1.37143 XP_016814391.1.37143 XP_017196894.1.1745 XP_017370436.1.71028 XP_017377402.1.71028 XP_017377403.1.71028 XP_017521949.1.32401 XP_017657642.1.79516 XP_017667932.1.3805 XP_017667933.1.3805 XP_017667934.1.3805 XP_017667935.1.3805 XP_017707113.1.44346 XP_017707114.1.44346 XP_017820905.1.60252 XP_017820906.1.60252 XP_017913889.1.57651 XP_017934839.1.51550 XP_017934847.1.51550 XP_017934856.1.51550 XP_017950141.1.99540 XP_018079296.1.7800 XP_018123372.1.7800 XP_018123373.1.7800 XP_018609521.1.37976 XP_018613199.1.37976 XP_018766708.1.15306 XP_018861222.1.82291 XP_018888291.1.27298 XP_018888292.1.27298 XP_018888293.1.27298 XP_018888294.1.27298 XP_018935115.1.5815 XP_018948718.1.5815 XP_019308842.1.44245 XP_019308843.1.44245 XP_019383360.1.87953 XP_019404882.1.79039 XP_019499163.1.44202 XP_019499164.1.44202 XP_019581396.1.88060 XP_019581401.1.88060 XP_019581402.1.88060 XP_020028111.1.5219 XP_020324098.1.87700 XP_020329151.1.87700 XP_020668565.1.8467 XP_020757651.1.74333 XP_020757652.1.74333 XP_020826681.1.61212 XP_020826682.1.61212 XP_020826683.1.61212 XP_020944849.1.46622 XP_021242886.1.32913 XP_021386271.1.53032 XP_021417916.1.32639 XP_021475714.1.32639 XP_021507797.1.76796 XP_021507799.1.76796 XP_021544322.1.83697 XP_021544323.1.83697 XP_021544324.1.83697 XP_535104.1.84170 ENSECAP00000000044 ENSPSIP00000003911 ENSNLEP00000001913 ENSSTOP00000022578 ENSSSCP00000006587 ENSPSIP00000003911 ENSP00000284811 ENSPPYP00000020952 gi|147899211|ref|NP_001080128| gi|32766703|gb|AAH55268| hso003001557.1 ENSDORP00000003419 10090.ENSMUSP00000111009 10116.ENSRNOP00000000132 9031.ENSGALP00000025184 9544.ENSMMUP00000006823 9598.ENSPTRP00000034827 9600.ENSPPYP00000020952 9606.ENSP00000284811 9615.ENSCAFP00000012003 9796.ENSECAP00000000044 9823.ENSSSCP00000006587 9913.ENSBTAP00000002843 ENSMMUP00000006823 ENSSHAP00000011604 ENSCJAP00000001009 ENSCJAP00000001011 ENSPVAP00000007655 ENSXETP00000025858 gi|325652033|ref|NP_001191786.1| gi|325652035|ref|NP_001191787.1| gi|325652037|ref|NP_001191788.1| gi|325652039|ref|NP_001191789.1| gi|325652041|ref|NP_001191790.1| gi|325652043|ref|NP_001191791.1| gi|5032161|ref|NP_005639.1| ENSP00000284811 ENSP00000428074 ENSP00000428171 ENSP00000428334 ENSP00000429596 ENSP00000429906 ENSP00000478121 ENSCJAP00000001009 ENSGALP00000025184 ENSCAFP00000039750 ENSMUSP00000111009 ENSMUSP00000139675 ENSMUSP00000140422 ENSMUSP00000140962 ENSRNOP00000000132 ENSPVAP00000007655 ENSBTAP00000002843 ENSBTAP00000002843 ENSVPAP00000001409 ENSXETP00000025858 ENSVPAP00000001409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]