SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001034 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001034
Domain Number 1 Region: 129-155,197-401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-60
Family Voltage-gated potassium channels 0.00069
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001034   Gene: ENSCJAG00000000600   Transcript: ENSCJAT00000001100
Sequence length 494
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:16595196:16728817:1 gene:ENSCJAG00000000600 transcript:ENSCJAT00000001100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYY
QSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLI
FEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPASGAN
GSGVVGQPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNI
IDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKG
LQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMT
TVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQ
GIQSQGPGLDRGVQRKVSGSRGSFCKAGVTLENADNAQRGSCPLEKCNVKAKSNVDLRRS
LYALCLDASRETDL
Download sequence
Identical sequences F7B3D9
ENSCJAP00000001034 ENSCJAP00000001034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]