SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001054 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000001054
Domain Number - Region: 29-63,110-151
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00124
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 
Domain Number - Region: 17-230
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0188
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number - Region: 271-414
Classification Level Classification E-value
Superfamily t-snare proteins 0.0863
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001054   Gene: ENSCJAG00000000595   Transcript: ENSCJAT00000001121
Sequence length 427
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:35860154:35882537:1 gene:ENSCJAG00000000595 transcript:ENSCJAT00000001121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTL
KDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQ
ISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFG
LSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKF
ARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKLKKWISELFQSHKKDFQEDAEMNKM
NEEKKLGVLGSREDLSKLSLDKRQLGHNKQASVRNSEDFRLNSFNNPPRQYQKIMKRLIK
RYVLQAQVDKESDEVNEGELKEIKQDISSLRYELLEEKSQNTQDLAELIRELGEKLSMEP
NQEKTNR
Download sequence
Identical sequences F7AK29
ENSCJAP00000001054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]