SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001064 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001064
Domain Number 1 Region: 32-65,108-177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.93e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-16
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001064   Gene: ENSCJAG00000000614   Transcript: ENSCJAT00000001131
Sequence length 325
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:60231951:60284401:1 gene:ENSCJAG00000000614 transcript:ENSCJAT00000001131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTCSPKQSPCRSRRRLTRPAKYYCRGSRSHLNEDTGRYVVLAALIGLYLVAGATVFSAL
ESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAF
YFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACR
ERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHVLLILGLFAVLLSCCASAMYTIVEG
WDYVDSLYFCFVIFNTIGFGDLVSSQHAAYRNQGLYRLGNFLLILLGVCCIYSLFTSSPS
SSFRCSLDAAHVNCRCCSRCCQCPG
Download sequence
Identical sequences F7AJJ8
ENSCJAP00000001064 ENSCJAP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]