SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001230 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001230
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.86e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000117
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000125
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001230   Gene: ENSCJAG00000000700   Transcript: ENSCJAT00000001305
Sequence length 867
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:61498259:61588071:-1 gene:ENSCJAG00000000700 transcript:ENSCJAT00000001305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSTSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLIAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN
FEESSTYGKAILPPSQPWATELRSTQSEAGSLPAFTVPQAAATGSTTPSATSSSSCSTPN
SPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLS
PICPEERLLPENPQSTPQNCFSAMTNIFQPLAPVASHSPFLLDKFQQQLESKKTEPEHRP
MSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPMKWAVGDQHTEFLG
AATLGPPVSPPHVSTFKTRSAKGFGARGPDMLSPAMVALSNKLKLKRQLEYEEQAFQDLS
GGDPPGGNTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFIQNPMRGLGQPLRHLPPP
QPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYD
CEVNVPVLGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences F6ZHN9
ENSCJAP00000001230 XP_002757844.1.60252 ENSCJAP00000001230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]