SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001452 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001452
Domain Number 1 Region: 1059-1320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 365-598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 2-134,183-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 742-895,935-1013
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001452
Domain Number - Region: 1325-1472
Classification Level Classification E-value
Superfamily EF-hand 0.0184
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001452   Gene: ENSCJAG00000000732   Transcript: ENSCJAT00000001540
Sequence length 2014
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:14070188:14316175:1 gene:ENSCJAG00000000732 transcript:ENSCJAT00000001540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCRPGWDGP
KHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEE
KPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRA
AVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLG
LQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSN
LVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTV
FQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADA
ESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEESKEEKIELKSITADGESPPTT
KINMDDLQPNENEDKSPYPNPETTGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASA
FFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIV
FTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCS
DSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPE
LLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQ
HYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVI
LSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQA
LPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ
DIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNF
DYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVA
CKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMK
LLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLH
DIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFP
QTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLP
RPTGHPSTVSTVEGHGPPLSPAIRVQEVAWKLSSQRERHVLVCEDLELRRDSGSGGTQAH
CLLFRRANPSRCHSRESQTAVVGQEETSQDETYEVKMNDDTEACSEPSLLSTEMLSYQDD
ENRQLTLPEEDKRDIRQSPKRGFLRTASLGRRASFHLECLKRQKDRAGDISQKTVLPLHL
VHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESIEKLN
SSFPSIHCGSWAETTPCGGGSSAARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISE
GLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAG
QDLAGGEEDAGCVLARGRLSEEELQDSRVYVSSL
Download sequence
Identical sequences F6WKW8
ENSCJAP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]