SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001539 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001539
Domain Number 1 Region: 1008-1258
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.18e-38
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 2-134,180-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 362-580
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-27
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 712-865,905-937
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001539
Domain Number - Region: 1263-1410
Classification Level Classification E-value
Superfamily EF-hand 0.0151
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001539   Gene: ENSCJAG00000000732   Transcript: ENSCJAT00000001635
Sequence length 1939
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:14070183:14315267:1 gene:ENSCJAG00000000732 transcript:ENSCJAT00000001635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIAAEDDPSPCALETGHGRQCQNGTVCRPGWDGPKHG
ITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLG
VLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPR
NMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVK
SNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQA
YFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVA
SLLNSVRSIALGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIM
AYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKK
LASQIPMEKRRERKTPSGKKASGDGQINMDDLQPNENEDKSPYPNPETTVHREKGEDDEE
EPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFF
ILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYF
NILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTI
GNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPR
SWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLI
VIGSIIDVILSETNNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALP
YVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDI
MLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDY
LTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACK
RLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLL
DQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDI
GPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQT
FTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRP
SLCPLQTVQTTGHQASAWCHSRESQTAVVGQEETSQDETYEVKMNDDTEACSFFHDRHLS
EGSELFSELESFEDRSGRCQGQARTSWGGNSPNRHVSTKLSYQDDENRQLTLPEEDKRDI
RQSPKRGFLRTASLGRRASFHLECLKRQKDRAGDISQKTVLPLHLVHHQALAVAGLSPLL
QRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESIEKLNSSFPSIHCGSWAETT
PCGGGSSAARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVT
TQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDLAGGEEDAGCVLA
RGRLSEEELQDSRVYVSSL
Download sequence
Identical sequences F6ZYB3
ENSCJAP00000001539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]