SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001792 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001792
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.3e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001792   Gene: ENSCJAG00000001006   Transcript: ENSCJAT00000001902
Sequence length 391
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:123175358:123180568:1 gene:ENSCJAG00000001006 transcript:ENSCJAT00000001902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGSNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLVMLEKTVEKCCISLNGQSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPALCPHVLRAPARVLGEAVLPFPPALAEVTLGIGRGCRVILRS
YHEEDADSTVRAMVTEVCLGEEDFQQLQAQEGAAITFCLKEFRGLLSFAESANLNLCIHF
DAPGRPAIFTVKDSLLDGHFVLATLSETDSYSQDLGSLERHRPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRALPSISLSPGPQPPQSPGSPSEEEDEAEPTTVPGTPPPKK
FRSLFFGSILAPVGSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences F6VYE3
ENSCJAP00000001792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]