SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001890 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001890
Domain Number 1 Region: 18-228
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.22e-39
Family Carbonic anhydrase 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001890   Gene: ENSCJAG00000001097   Transcript: ENSCJAT00000002004
Sequence length 256
Comment pep:novel chromosome:C_jacchus3.2.1:5:86864889:86874739:-1 gene:ENSCJAG00000001097 transcript:ENSCJAT00000002004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMLLALLALSSARPSAGADSHWCYETQAEASNYTCLGPGKWGGSCQKDRQSPINIVTAK
AEVDKKLGHFFFSGYDKKQKWTVQNNGHSVMMLLGNKASVSGGGLPARYQATQLHLHWSK
WLDEGSEHSLDGERFAMEVSAPTGTLSGLWVCTCLGQAANECSRDMMGCLPDVTCAGSAA
SPATPAEPLLPQILAFSQKLFYDKDQKLNMAENVRPKQRRGQRTVFKSGAPGQPLPWALP
ALLGPTLAWLLAGFLQ
Download sequence
Identical sequences F7ADG4
ENSCJAP00000001890 ENSCJAP00000001890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]