SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001901 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001901
Domain Number 1 Region: 158-378
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-33
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 394-556
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000919
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001901   Gene: ENSCJAG00000001073   Transcript: ENSCJAT00000002015
Sequence length 1223
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:46376705:47148660:1 gene:ENSCJAG00000001073 transcript:ENSCJAT00000002015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSVHEPKMDALIIPV
TMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINN
GSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALV
IYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFF
TVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLT
AAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFI
LGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDR
DDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANK
YCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAE
LKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGL
SFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRA
FFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVD
TLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLI
PGNDQIDNMDSNVKKYDSTGMFHWCAPKDIEKVILTRSEAAMTVLSGHVVVCIFGDVSSA
LIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLR
AVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPG
MDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFA
CGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLA
NRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTK
RYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTA
NRQNRPKSRESRDKQKYVQEERL
Download sequence
Identical sequences F6YCD5
ENSCJAP00000001901 ENSCJAP00000001834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]