SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002006 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002006
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.98e-64
Family Alanine racemase-like, N-terminal domain 0.0000000478
Further Details:      
 
Domain Number 2 Region: 249-348
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000000000126
Family Eukaryotic ODC-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002006   Gene: ENSCJAG00000034957   Transcript: ENSCJAT00000002124
Sequence length 459
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:67323602:67359857:1 gene:ENSCJAG00000034957 transcript:ENSCJAT00000002124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLSESDFVMVEEGFSTQDLLEELTLGASQATTDKASAFFVADLGAIVRKHFYFLKCL
PRVRPFYVVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIIYANPCKQIAQ
IKYAAKRGIQLLSFDNEMELAKVVKSHPSAKMVLCIANDDSHSLNRLSLKFGVPLKSCRH
LLESAKKSHVEVVGVSFHVGSGCPDPQAYAQSIADARLVFEMGTELGHRMHVLDLGGGFP
GTEGAKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFAVAVSITAKKEVLLD
QPGREEENGSAPKTFVYHLDEGVYGIFNSVLFDNICPTPVLQKASVATSWALATPLLFPP
CLIGTSPVAWLPTSRIYWWLVYLNEGWGHTGVGSSWGGVSSLPLSLPSAELRLREALRRQ
LMAAEQEDDMEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences F7I7B9
ENSCJAP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]