SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002010 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002010
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.54e-64
Family Alanine racemase-like, N-terminal domain 0.0000000478
Further Details:      
 
Domain Number 2 Region: 249-362
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000046
Family Eukaryotic ODC-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002010   Gene: ENSCJAG00000034957   Transcript: ENSCJAT00000002127
Sequence length 473
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:67323602:67359857:1 gene:ENSCJAG00000034957 transcript:ENSCJAT00000002127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLSESDFVMVEEGFSTQDLLEELTLGASQATTDKASAFFVADLGAIVRKHFYFLKCL
PRVRPFYVVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIIYANPCKQIAQ
IKYAAKRGIQLLSFDNEMELAKVVKSHPSAKMVLCIANDDSHSLNRLSLKFGVPLKSCRH
LLESAKKSHVEVVGVSFHVGSGCPDPQAYAQSIADARLVFEMGTELGHRMHVLDLGGGFP
GTEGAKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFAVAVSITAKKEVLLD
QPGREGSPIPPHIATCAAPDPSPPAEENGSAPKTFVYHLDEGVYGIFNSVLFDNICPTPV
LQKVSLPHVGVFSILCVPAASTSSCLSLPMLNMCGFLSLVEGWGHTGVGSSWGGPHAGYL
QHPSLTLREALRRQLMAAEQEDDMEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences F7I797
ENSCJAP00000001999 ENSCJAP00000002010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]