SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002195 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002195
Domain Number 1 Region: 278-581
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-49
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 8.89e-33
Family BTB/POZ domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002195   Gene: ENSCJAG00000001239   Transcript: ENSCJAT00000002316
Sequence length 611
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:96037355:96245635:1 gene:ENSCJAG00000001239 transcript:ENSCJAT00000002316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIADEQKFHAHKAVLAACSDYFRAMF
SLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGSHLQLLELLNLC
SHYLIQELNSFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPEDVLTLPYCLLQ
EVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLV
QASETATALVNEALEYHQSIYAQPVWQTCRTKPRFQSDTLYIIGGKKREVCKVKELRYFN
PVDQENALIAAIANWSELAPMPVGRSHHCVAVMGDFLFVAGGEVEHASGRTCAVRTACRY
DPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYCPKKNKWTFVQS
FDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQSKLVIGMPSLHTQICILHLY
REKLCHFYDLGNNALTFLNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRI
YLVGGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQT
LQVPHHRIGTI
Download sequence
Identical sequences F7I9K9
ENSCJAP00000002195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]