SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002449 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002449
Domain Number 1 Region: 141-242
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-20
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 74-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.8e-20
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002449   Gene: ENSCJAG00000001389   Transcript: ENSCJAT00000002586
Sequence length 309
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:81716155:81760235:-1 gene:ENSCJAG00000001389 transcript:ENSCJAT00000002586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKPEVIRVLNIICFSITYKDVGAEVFDEGEYVPESIDRHRLELKQQEHRERSNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSLYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
PMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFR
GLMKRRSSV
Download sequence
Identical sequences F7I001
ENSCJAP00000002449 ENSCJAP00000002449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]