SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002463 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002463
Domain Number 1 Region: 165-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.66e-79
Family Eukaryotic proteases 0.00000000258
Further Details:      
 
Domain Number 2 Region: 48-156
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-31
Family Kringle modules 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002463   Gene: ENSCJAG00000001364   Transcript: ENSCJAT00000002602
Sequence length 430
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:50214092:50220393:-1 gene:ENSCJAG00000001364 transcript:ENSCJAT00000002602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLLVRLLLCVLIVSDSKGRREHQVPSNCDCLNGGTCVSSKYFSNTRWCNCPKKFGGLH
CEIDNSKTCYEGNGHFYRGKAKTDIMGRSCLSWNSAAVLQQTYHAHRSDALQLGLGKHNY
CRNPDNRRRPWCYVQVGLKQLVQECTVHNCADGKKPSSPPAELEFQCGQKPLTPRFKIIG
GEYTTIENQPWFAAIYRQHRGGSVTYLCGGSLISPCWVVSATHCFINHAVKEDFIVYLGR
SRLNSNTPGEMRFDVENLILHEGYSADTLAHHNDIALLKIRSKEGKCAQPSRTIQTICLP
PMLNDARFGTSCEITGFGKENTTDYFYPEQLKMTVVKLVSHQECQQPNYYGSEVTTKMLC
AADPQWETDSCQGDSGGPLICSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIRR
HTKEENGPAV
Download sequence
Identical sequences F7HXM8
XP_002756262.1.60252 ENSCJAP00000002463 ENSCJAP00000002463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]