SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002604 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002604
Domain Number 1 Region: 276-536
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-62
Family Kelch motif 0.0000448
Further Details:      
 
Domain Number 2 Region: 17-117
Classification Level Classification E-value
Superfamily POZ domain 2.75e-31
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002604   Gene: ENSCJAG00000001422   Transcript: ENSCJAT00000002749
Sequence length 564
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:32609842:32681333:-1 gene:ENSCJAG00000001422 transcript:ENSCJAT00000002749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGSDFRTLLTSHINLKKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKS
FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVD
ASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTVR
AEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKM
VISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCP
FEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEG
KIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNN
VSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYD
IKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVR
AFPVTSCLICVVDTCGANEETLET
Download sequence
Identical sequences F7I6U4
ENSCJAP00000002604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]