SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002628 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002628
Domain Number 1 Region: 20-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.57e-24
Family Ribosomal L11/L12e N-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 83-158
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.49e-18
Family Ribosomal protein L11, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002628   Gene: ENSCJAG00000001470   Transcript: ENSCJAT00000002773
Sequence length 195
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122163786:122167359:-1 gene:ENSCJAG00000001470 transcript:ENSCJAT00000002773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVSRVSRATRALRKPEVGGVIRTIVRAGQAMPGPPLGPVLGQRGVSINQFCKEFNERT
KDIKKGIPLPTKIFVKPDRTFDIKIGQPTISYFLKAAAGIEKGARQTGKEVAGLVTLKHV
YEIALVKAQDEVFVLQDVPLSSVVRSIIGSARSMGIRVVKDLGSEELAAFQKERAIFLAA
QKEADLAAQEEAAKK
Download sequence
Identical sequences F7I4J3
ENSCJAP00000002628 ENSCJAP00000002631 XP_002755661.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]