SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002723 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002723
Domain Number 1 Region: 47-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002723   Gene: ENSCJAG00000001530   Transcript: ENSCJAT00000002874
Sequence length 200
Comment pep:novel chromosome:C_jacchus3.2.1:17:30487149:30487820:-1 gene:ENSCJAG00000001530 transcript:ENSCJAT00000002874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVPQVEVLEDRLPDEIGPLLQLAAICRLKRLPSGGCSSTQDLYWCWKRRRVANARERERQ
NLNHGFARLKALVPFLSQSRKPSKVDILKGATGCIHVLSHVLEEAEDSGEQGPDEQSSSN
STSEPHISSARELSRNITQGVGCAFSFKNEEEEPWAHGGSGEPAHSCSQRVLSTTGVMSP
TRSLDRLPEVQLLSHRLPQV
Download sequence
Identical sequences F7IQN9
ENSCJAP00000002723 ENSCJAP00000002723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]