SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002825 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002825
Domain Number 1 Region: 5-361
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.1e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 381-496,615-755
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.45e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000002825
Domain Number - Region: 467-610
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.002
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002825   Gene: ENSCJAG00000001552   Transcript: ENSCJAT00000002982
Sequence length 859
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:100924825:101424206:1 gene:ENSCJAG00000001552 transcript:ENSCJAT00000002982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGP
SHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKW
KTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFD
CSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQV
SSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNR
HKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPAS
GLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRE
LSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDF
SKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEW
YNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIIS
SYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFM
SSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTP
MGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAA
GLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEE
VINMHTFNDRRLPGKETMA
Download sequence
Identical sequences A0A0D9RQB5 A0A287DGA9 F7IBH6
XP_003258428.1.23891 XP_004637508.1.9945 XP_005267003.1.92137 XP_011791898.1.43180 ENSCJAP00000002825 ENSCJAP00000002825 ENSP00000358130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]