SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002896 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002896
Domain Number 1 Region: 414-528,647-793
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-65
Family Phosphate binding protein-like 0.000000000655
Further Details:      
 
Domain Number 2 Region: 23-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-54
Family L-arabinose binding protein-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002896   Gene: ENSCJAG00000001564   Transcript: ENSCJAT00000003061
Sequence length 882
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:34881662:35024263:-1 gene:ENSCJAG00000001564 transcript:ENSCJAT00000003061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSECIVEGEWWFFTLIIISYTANLAAFLTVERMVSPIESAEDLS
KQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKY
AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLD
KLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRA
EAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences F7I4C8
ENSCJAP00000002896 ENSCJAP00000002896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]