SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003055 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003055
Domain Number 1 Region: 89-200
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003055   Gene: ENSCJAG00000001695   Transcript: ENSCJAT00000003224
Sequence length 213
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:99842115:99877475:1 gene:ENSCJAG00000001695 transcript:ENSCJAT00000003224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRSAAGFLLWPSYTSPAQVQTVTRAPRPGELAQLCDCRALHTGIAKICASRHASL
NLRGLNQIQNVKKQSAYLMNLRKTGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKP
YTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSH
DGVSLHELLAAELTKALKTKLDLSYLAYSGKDA
Download sequence
Identical sequences F7G7D3
XP_002742919.1.60252 ENSCJAP00000003055 ENSCJAP00000003046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]