SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003153 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003153
Domain Number 1 Region: 73-175
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 4.05e-18
Family Glutamine synthetase, N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003153   Gene: ENSCJAG00000001759   Transcript: ENSCJAT00000003328
Sequence length 208
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:61654131:61695163:-1 gene:ENSCJAG00000001759 transcript:ENSCJAT00000003328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNEEDLLQEDSKRDEGNETEANSMYKLRKTRKKVTKSHVCSTEVGEMDISNLNDCMRDS
SQILTPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRFKSIPAHFFQEKVSQGVCMP
RGYLEVMPNPKDNEMNHLRATCFNSDIVLMPEVSTFRVLPWAERTARVICDTFTVTVSGM
SKGRKTCSAAVLELSSSRSLGKNGWQDS
Download sequence
Identical sequences F7DFP2
XP_008992872.1.60252 ENSCJAP00000003153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]