SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003251 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003251
Domain Number 1 Region: 116-254
Classification Level Classification E-value
Superfamily dUTPase-like 4.45e-49
Family dUTPase-like 0.000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003251   Gene: ENSCJAG00000001813   Transcript: ENSCJAT00000003431
Sequence length 255
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:25476550:25493775:1 gene:ENSCJAG00000001813 transcript:ENSCJAT00000003431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPICPRPALCYHFLPSLLRSAIQNATGARLRAEAAGLSEPGQSLGRVAQHGRPRAAVQR
CRLSRAAESQYRLETVGEVGRRSPRSPSGSTMPSSEETPAVSPSKRARPAEEGVMQLRFA
RLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLA
AKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALD
DTKRGSGGFGSTGKN
Download sequence
Identical sequences F7GPR6
ENSCJAP00000003251 ENSCJAP00000003251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]