SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003443 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003443
Domain Number 1 Region: 10-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.83e-68
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 413-526,645-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-63
Family Phosphate binding protein-like 0.00000000288
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003443
Domain Number - Region: 548-640
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00165
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003443   Gene: ENSCJAG00000001873   Transcript: ENSCJAT00000003633
Sequence length 850
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:71185351:71415710:-1 gene:ENSCJAG00000001873 transcript:ENSCJAT00000003633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAFWIPDSRGRPHVIRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTY
DIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHP
LDNKDTFYVNLYPDYASLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIR
LKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTT
LDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWSMERLQAAPKAESGLLDGVMMT
DAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFN
KTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTV
LEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWN
GMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPL
SPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSL
MQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTK
IEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMEST
TIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWR
GSGCPEEENKEASALGVQKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQVSLRAW
SLHRTGDLRQ
Download sequence
Identical sequences F7GZR3
ENSCJAP00000003443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]