SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003608 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003608
Domain Number 1 Region: 206-336
Classification Level Classification E-value
Superfamily TPR-like 1.22e-27
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 92-178
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000171
Family FKBP immunophilin/proline isomerase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003608   Gene: ENSCJAG00000002003   Transcript: ENSCJAT00000003801
Sequence length 346
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:32697175:32698785:-1 gene:ENSCJAG00000002003 transcript:ENSCJAT00000003801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVSTIGERDTSQPEQQWEKNPRENLDSVTQISQQPPTETLELGVSPDSASQILENI
QGTEKLVAEPEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIIIHGHGLDKPKLGSC
CRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGP
PVRLTLASFTQGRDSWELETSEKEALAKEERARGTELFRAGNPEGAARCYGRALRLLLTL
PPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLE
KATADLRKVLAIDPKNRAAQEELGKVVVQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences F7HA05
ENSCJAP00000003608 XP_002746420.1.60252 XP_008992445.1.60252 XP_008992446.1.60252 ENSCJAP00000003608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]